| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-MGMT monoclonal antibody (ZM314) 6255
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to MGMT
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG1
- Control: Colon carcinoma
- Visualization: Nuclear
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-MGMT monoclonal antibody ZM314 6255
| target relevance |
|---|
| Homo sapiens MGMT Methylated-DNA--protein-cysteine methyltransferase |
| Protein names Methylated-DNA--protein-cysteine methyltransferase |
| Alternative names 6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase |
| Gene names MGMT |
| Protein family Belongs to the MGMT family |
| Function Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated |
| Catalytic activity a 6-O-methyl-2'-deoxyguanosine in DNA + L-cysteinyl-[protein] = S-methyl-L-cysteinyl-[protein] + a 2'-deoxyguanosine in DNA a 4-O-methyl-thymidine in DNA + L-cysteinyl-[protein] = a thymidine in DNA + S-methyl-L-cysteinyl-[protein] |
| Subcellular location Nucleus |
| Keywords 3D-structure, Direct protein sequencing, DNA damage, DNA repair, DNA-binding, Metal-binding, Methyltransferase, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transferase, Zinc |
| Sequence MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG LGGSSGLAGAWLKGAGATSGSPPAGRN |
| UniProt accession: P16455 |
Data
![]() |
| Formalin-fixed, paraffin-embedded human glioma stained with MGMT antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-MGMT monoclonal antibody (ZM314) suitable for?
This antibody is suitable for Immunohistochemistry (IHC) applications, specifically for formalin-fixed, paraffin-embedded human tissues.
How should the mouse anti-MGMT monoclonal antibody be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be stored at -20°C while avoiding repeated freeze/thaw cycles.
What species does the mouse anti-MGMT monoclonal antibody (ZM314) react with?
This antibody specifically reacts with human MGMT protein.
What is the recommended dilution range for using the concentrated mouse anti-MGMT monoclonal antibody in IHC?
The recommended dilution for the concentrated antibody in Immunohistochemistry is between 1:100 and 1:200.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.