Immunohistochemistry (IHC) : Human melanoma stained with anti-Melan-A antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of melanoma cells.

mouse anti-Melan-A (MART-1) monoclonal antibody (A103) 6251

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Melan-A (MART-1)
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Skin or melanoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6251parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Dermatopathology, Melan-A (MART-1)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Melan-A (MART-1) monoclonal antibody A103 6251

antibody
Database link: human Q16655
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Skin or melanoma
Immunogen Recombinant MART-1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens MLANA Melanoma antigen recognized by T-cells 1
Protein names Melanoma antigen recognized by T-cells 1
Alternative names Antigen LB39-AA, Antigen SK29-AA, Protein Melan-A
Gene names MLANA
Function Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes
Subcellular location Endoplasmic reticulum membrane, Golgi apparatus, Golgi apparatus, trans-Golgi network membrane, Melanosome
Structure Interacts with PMEL. Interacts with GPR143
Post-translational modification Acylated
Keywords 3D-structure, Endoplasmic reticulum, Golgi apparatus, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Transmembrane, Transmembrane helix
Sequence MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
UniProt accession: Q16655

Data

Human melanoma stained with anti-Melan-A antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of melanoma cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution range for using the mouse anti-Melan-A (MART-1) monoclonal antibody (A103) in immunohistochemistry?

For immunohistochemistry applications, the concentrated mouse anti-Melan-A (MART-1) monoclonal antibody (A103) is recommended to be diluted between 1:50 and 1:100.

How should the mouse anti-Melan-A (MART-1) monoclonal antibody be stored to maintain its stability?

The antibody should be stored at 2-8°C for short term use, and for longer term storage, it should be kept at -20°C. It is important to avoid freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.