| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2a |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | JAB-1 |
| available sizes | 100 µg |
mouse anti-JAB-1 monoclonal antibody (8H8.5) 4717
$503.00
Antibody summary
- Mouse monoclonal to JAB-1
- Suitable for: WB,IP
- Isotype: IgG2a
- 100 µg
mouse anti-JAB-1 monoclonal antibody (8H8.5) 4717
| antibody |
|---|
| Tested applications WB,IP |
| Recommended dilutions Immunoblotting and Immunoprecipitation: use at 0.5-1 ug/mL. Positive controls: 293 cells and recombinant fusion protein. |
| Immunogen Mouse JAB-1 gst-fusion protein (aa 1-334) expressed in E. coli. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG2a |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2a - Isotype Control |
| target relevance |
|---|
| Homo sapiens COPS5 COP9 signalosome complex subunit 5 |
| Protein names COP9 signalosome complex subunit 5 |
| Alternative names Jun activation domain-binding protein 1 |
| Gene names COPS5 |
| Protein family Belongs to the peptidase M67A family. CSN5 subfamily |
| Function Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex. Promotes the proteasomal degradation of BRSK2 |
| Subcellular location Cytoplasm, cytosol, Nucleus, Cytoplasm, perinuclear region, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle |
| Structure Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1 (PubMed:26456823). In the complex, it probably interacts directly with COPS1, COPS2, COPS4, COPS6 and COPS7 (COPS7A or COPS7B) and COPS9 isoform 1 (PubMed:26456823). Interacts with COPS9 isoform 2 (PubMed:23776465). The CSN complex interacts with the BRISC complex. Also exists as monomeric form. Interacts with TP53, MIF, JUN, UCHL1, NCOA1, HIF1A, CDKN1B, BCL3, GFER, PGR, LHCGR, SMAD4, SMAD7, ID1, ID3, ITGB2 and TOP2A. Part of a complex consisting of RANBP9, Ran, DYRK1B and COPS5. Interacts with IFIT3. Interacts with BRSK2. Interacts with ZDHHC16 (PubMed:17123647). Interacts with MINDY3 (PubMed:21499297). Interacts with FANK1; regulates the phosphorylation of JUN and the transcriptional activity of AP-1 (PubMed:20978819). Interacts with NUPR1; this interaction allows COPS5-dependent CDKN1B nuclear to cytoplasm translocation (PubMed:16300740) |
| Keywords 3D-structure, Acetylation, Cytoplasm, Cytoplasmic vesicle, Direct protein sequencing, Hydrolase, Metal-binding, Metalloprotease, Nucleus, Protease, Proteomics identification, Reference proteome, Signalosome, Synapse, Zinc |
| Sequence MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS |
| UniProt accession: Q92905 |
Data
 |
| Part of a customer review using 4717 |
 |
| Detection of human Jab1 protein in HeLa whole cell lysate using monoclonal antibody 4717 |
 |
| Customer Review using 4717 - D10 T cells were lysed in IP buffer (20mM Tris-HCl, pH 7.5, 50mM NaCl, 50mM NaF, 10mM -glycerophosphate, 1% Triton X-100, 1mM PMSF). |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-JAB-1 monoclonal antibody (8H8.5) validated for?
This monoclonal antibody is validated for Western blotting (WB) and immunoprecipitation (IP) applications. It is also suitable for immunocytochemistry/immunofluorescence (ICC/IF). Recommended dilutions for immunoblotting and immunoprecipitation range from 0.5 to 1 µg/mL.
How should the mouse anti-JAB-1 monoclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species and clonality of this anti-JAB-1 antibody?
This antibody is a mouse monoclonal antibody with an IgG2a isotype, ensuring specificity and consistency in experimental applications.
What is the immunogen used to generate this mouse anti-JAB-1 monoclonal antibody?
The immunogen is a mouse JAB-1 GST-fusion protein corresponding to amino acids 1-334, expressed in Escherichia coli.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.