Skip to content

mouse anti-JAB-1 monoclonal antibody (8H8.5) 4717

$503.00

Antibody summary

  • Mouse monoclonal to JAB-1
  • Suitable for: WB,IP
  • Isotype: IgG2a
  • 100 µg
SKU: 4717parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG2a

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

JAB-1

available sizes

100 µg

mouse anti-JAB-1 monoclonal antibody (8H8.5) 4717

antibody
Tested applications
WB,IP
Recommended dilutions
Immunoblotting and

Immunoprecipitation: use at 0.5-1 ug/mL.

Positive controls: 293 cells and recombinant fusion protein.
Immunogen
Mouse JAB-1 gst-fusion protein (aa 1-334) expressed in E. coli.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG2a
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG2a - Isotype Control
target relevance
Homo sapiens COPS5
COP9 signalosome complex subunit 5
Protein names
COP9 signalosome complex subunit 5
Alternative names
Jun activation domain-binding protein 1
Gene names
COPS5
Protein family
Belongs to the peptidase M67A family. CSN5 subfamily
Function
Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex. Promotes the proteasomal degradation of BRSK2
Subcellular location
Cytoplasm, cytosol, Nucleus, Cytoplasm, perinuclear region, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle
Structure
Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1 (PubMed:26456823). In the complex, it probably interacts directly with COPS1, COPS2, COPS4, COPS6 and COPS7 (COPS7A or COPS7B) and COPS9 isoform 1 (PubMed:26456823). Interacts with COPS9 isoform 2 (PubMed:23776465). The CSN complex interacts with the BRISC complex. Also exists as monomeric form. Interacts with TP53, MIF, JUN, UCHL1, NCOA1, HIF1A, CDKN1B, BCL3, GFER, PGR, LHCGR, SMAD4, SMAD7, ID1, ID3, ITGB2 and TOP2A. Part of a complex consisting of RANBP9, Ran, DYRK1B and COPS5. Interacts with IFIT3. Interacts with BRSK2. Interacts with ZDHHC16 (PubMed:17123647). Interacts with MINDY3 (PubMed:21499297). Interacts with FANK1; regulates the phosphorylation of JUN and the transcriptional activity of AP-1 (PubMed:20978819). Interacts with NUPR1; this interaction allows COPS5-dependent CDKN1B nuclear to cytoplasm translocation (PubMed:16300740)
Keywords
3D-structure, Acetylation, Cytoplasm, Cytoplasmic vesicle, Direct protein sequencing, Hydrolase, Metal-binding, Metalloprotease, Nucleus, Protease, Proteomics identification, Reference proteome, Signalosome, Synapse, Zinc
Sequence
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
UniProt accession: Q92905

Data

benchmark-antibodies_anti-jab-1_antibody_4717_1.jpg
Part of a customer review using 4717
benchmark-antibodies_anti-jab-1_antibody_4717_2.jpg
Detection of human Jab1 protein in HeLa whole cell lysate using monoclonal antibody 4717
benchmark-antibodies_anti-jab-1_antibody_4717_3.jpg
Customer Review using 4717 - D10 T cells were lysed in IP buffer (20mM Tris-HCl, pH 7.5, 50mM NaCl, 50mM NaF, 10mM -glycerophosphate, 1% Triton X-100, 1mM PMSF).

FAQ & Publications

Frequently Asked Questions
What applications is the mouse anti-JAB-1 monoclonal antibody (8H8.5) validated for?
This monoclonal antibody is validated for Western blotting (WB) and immunoprecipitation (IP) applications. It is also suitable for immunocytochemistry/immunofluorescence (ICC/IF). Recommended dilutions for immunoblotting and immunoprecipitation range from 0.5 to 1 µg/mL.
How should the mouse anti-JAB-1 monoclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species and clonality of this anti-JAB-1 antibody?
This antibody is a mouse monoclonal antibody with an IgG2a isotype, ensuring specificity and consistency in experimental applications.
What is the immunogen used to generate this mouse anti-JAB-1 monoclonal antibody?
The immunogen is a mouse JAB-1 GST-fusion protein corresponding to amino acids 1-334, expressed in Escherichia coli.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.