| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Insulin |
| available sizes | 200 µg |
mouse anti-Insulin monoclonal antibody (7F8) 5262
$364.00
Antibody summary
- Mouse monoclonal to Insulin
- Suitable for: ELISA
- Isotype: IgG1
- 200 µg
mouse anti-Insulin monoclonal antibody (7F8) 5262
| antibody |
|---|
| Tested applications ELISA |
| Immunogen Purified human insulin |
| Size and concentration 200µg and lot specific |
| Form liquid |
| Storage Instructions These antibodies are stable for at least one (1) year at -20°C to -70°C. May also be stored at 4°C. |
| Storage buffer PBS, pH 7.4, 0.09% NaN3. |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens INS Insulin |
| Protein names Insulin |
| Gene names INS |
| Protein family Belongs to the insulin family |
| Function Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
| Subcellular location Secreted |
| Structure Heterodimer of a B chain and an A chain linked by two disulfide bonds (PubMed:25423173) |
| Involvement in disease Hyperproinsulinemia An autosomal dominant condition characterized by elevated levels of serum proinsulin-like material. Type 1 diabetes mellitus 2 A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical features are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Diabetes mellitus, permanent neonatal, 4 A form of permanent neonatal diabetes mellitus, a type of diabetes characterized by onset of persistent hyperglycemia within the first six months of life. Initial clinical manifestations include intrauterine growth retardation, hyperglycemia, glycosuria, osmotic polyuria, severe dehydration, and failure to thrive. PNDM4 transmission pattern is consistent with autosomal dominant or autosomal recessive inheritance. Maturity-onset diabetes of the young 10 A form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. |
| Keywords 3D-structure, Alternative splicing, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Direct protein sequencing, Disease variant, Disulfide bond, Glucose metabolism, Hormone, Pharmaceutical, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN |
| UniProt accession: P01308 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Insulin monoclonal antibody (7F8) been tested for?
This antibody has been tested and is suitable for ELISA, ICC/IF (immunocytochemistry/immunofluorescence), and Western Blot (WB) applications.
How should the mouse anti-Insulin monoclonal antibody (7F8) be stored to maintain stability?
The antibody is stable for at least one year when stored at temperatures between -20°C to -70°C. It may also be stored at 4°C for shorter durations. The storage buffer is PBS, pH 7.4, containing 0.09% sodium azide.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.