| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2a |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-Inhibin-α monoclonal antibody (ZM113) 6229
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to Inhibin-α
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG2a
- Control: Adrenal cortex, testis, corpus luteum
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-Inhibin-α monoclonal antibody ZM113 6229
| antibody |
|---|
| Database link: human P05111 |
| Tested applications IHC |
| Recommended dilutions Concentrated 1:50-100 |
| Application Notes Positive control: Adrenal cortex, testis, corpus luteum |
| Immunogen A synthetic peptide (around aa 73-¬96) of α-subunit of human inhibin A protein |
| Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated |
| Form liquid |
| Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles. |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG2a |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monoclonal IgG2a - Isotype Control |
| target relevance |
|---|
| Homo sapiens INHA Inhibin alpha chain |
| Protein names Inhibin alpha chain |
| Gene names INHA |
| Protein family Belongs to the TGF-beta family |
| Function Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins |
| Subcellular location Secreted |
| Structure Dimeric, linked by one or more disulfide bonds. Activin B is a dimer of alpha and beta-B. Inhibin A is a dimer of alpha and beta-A (PubMed:11786387). Inhibin B is a dimer of alpha and beta-B (PubMed:11786387). Interacts with TGFBR3L; this interaction regulates female fertility |
| Post-translational modification Proteolytic processing yields a number of bioactive forms. The 20/23 kDa forms consist solely of the mature alpha chain, the 26/29 kDa forms consist of the most N-terminal propeptide linked through a disulfide bond to the mature alpha chain, the 50/53 kDa forms encompass the entire proprotein. Each type can be furthermore either mono- or diglycosylated, causing the mass difference |
| Keywords Cleavage on pair of basic residues, Direct protein sequencing, Disulfide bond, Glycoprotein, Growth factor, Hormone, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPR RHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQH TRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLH LATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWP WSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLT QHCACI |
| UniProt accession: P05111 |
Data
![]() |
| Human adrenal cortical tumor stained with anti-inhibin a antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells. |
FAQ & Publications
Frequently Asked Questions
What species does the mouse anti-Inhibin-α monoclonal antibody (ZM113) specifically react with?
This monoclonal antibody specifically reacts with human Inhibin-α, as confirmed by its reactivity profile.
How should the mouse anti-Inhibin-α monoclonal antibody (ZM113) be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.
What applications and sample types is this mouse anti-Inhibin-α monoclonal antibody validated for?
The antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples, with recommended dilutions of 1:50 to 1:100 for the concentrated form.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.