Immunohistochemistry (IHC) : Human granulosa cell tumor stained with anti-Inhibin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

mouse anti-Inhibin-α monoclonal antibody (R1) 6429

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Inhibin-α
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Adrenal cortex
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6429parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, inhibin-alpha, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Inhibin-α monoclonal antibody R1 6429

antibody
Database link: human P05111
Tested applications IHC
Recommended dilutions Concentrated 1:10
Application Notes Adrenal cortex
Immunogen Recombinant fragment within Human IMP3
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens INHA Inhibin alpha chain
Protein names Inhibin alpha chain
Gene names INHA
Protein family Belongs to the TGF-beta family
Function Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins
Subcellular location Secreted
Structure Dimeric, linked by one or more disulfide bonds. Activin B is a dimer of alpha and beta-B. Inhibin A is a dimer of alpha and beta-A (PubMed:11786387). Inhibin B is a dimer of alpha and beta-B (PubMed:11786387). Interacts with TGFBR3L; this interaction regulates female fertility
Post-translational modification Proteolytic processing yields a number of bioactive forms. The 20/23 kDa forms consist solely of the mature alpha chain, the 26/29 kDa forms consist of the most N-terminal propeptide linked through a disulfide bond to the mature alpha chain, the 50/53 kDa forms encompass the entire proprotein. Each type can be furthermore either mono- or diglycosylated, causing the mass difference
Keywords Cleavage on pair of basic residues, Direct protein sequencing, Disulfide bond, Glycoprotein, Growth factor, Hormone, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPR RHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQH TRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLH LATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWP WSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLT QHCACI
UniProt accession: P05111

Data

Human granulosa cell tumor stained with anti-Inhibin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended application for the mouse anti-Inhibin-α monoclonal antibody (R1) 6429?

This antibody is suitable for immunohistochemistry (IHC) applications, specifically on formalin-fixed, paraffin-embedded tissues.

Which species does the mouse anti-Inhibin-α monoclonal antibody (R1) 6429 react with?

The antibody reacts specifically with human tissues.

How should the mouse anti-Inhibin-α monoclonal antibody (R1) 6429 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C and freeze/thaw cycles must be avoided.

What is the host and clonality of the anti-Inhibin-α antibody R1 clone 6429?

The antibody is a mouse monoclonal antibody with an IgG2a isotype.

Are there compatible secondary antibodies recommended for use with the mouse anti-Inhibin-α monoclonal antibody (R1) 6429?

Yes, compatible secondary antibodies include goat anti-mouse IgG, H&L chain specific polyclonal antibodies conjugated to peroxidase, biotin, or FITC, with options for cross-absorbed variants.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.