| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | P-Cadherin |
| available sizes | 100 µg |
mouse anti-Human P-cadherin monoclonal antibody (NCC-CAD-299) 8198
$484.00
Antibody summary
- Mouse monoclonal to Human P-cadherin
- Suitable for: WB,IHC,Inhibition
- Isotype: IgG1
- 100 µg
mouse anti-Human P-cadherin monoclonal antibody (NCC-CAD-299) 8198
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Western Blotting: 5-10 ug/ml, non-reducing and non-heating conditions. Immunohistochemistry: 5-10 ug/ml, frozen tissue sections. Cell Contact Inhibition Assays: 100 ug/ml |
| Immunogen Human epidermal carcinoma cell line A431. |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions Lyophilized antibody is stable at 4°C for 2 years. Store the reconstituted solution in aliquots at -20°C for one year or at 4°C for 6 months after addition of 0.1% sodium azide by th |
| Storage buffer 10 mM PBS, pH 7.4, lyophilized |
| Purity immunogen affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens CDH3 Cadherin-3 |
| Protein names Cadherin-3 |
| Alternative names Placental cadherin |
| Gene names CDH3 |
| Function Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types |
| Subcellular location Cell membrane |
| Structure Interacts with CDCP1 and CTNNB1 |
| Involvement in disease Hypotrichosis congenital with juvenile macular dystrophy A disorder characterized by congenital hypotrichosis, early hair loss, and severe degenerative changes of the retinal macula that culminate in blindness during the second to third decade of life. Ectodermal dysplasia, ectrodactyly, and macular dystrophy syndrome A form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. It is an autosomal recessive condition characterized by features of ectodermal dysplasia such as sparse eyebrows and scalp hair, and selective tooth agenesis associated with macular dystrophy and ectrodactyly. |
| Keywords 3D-structure, Alternative splicing, Calcium, Cell adhesion, Cell membrane, Cleavage on pair of basic residues, Disease variant, Ectodermal dysplasia, Glycoprotein, Hypotrichosis, Membrane, Metal-binding, Proteomics identification, Reference proteome, Repeat, Sensory transduction, Signal, Transmembrane, Transmembrane helix, Vision |
| Sequence MGLPRGPLASLLLLQVCWLQCAASEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPG QEPALFSTDNDDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENG KGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAK YELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTAT DEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQA TDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSP AWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKL PTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKISYRILR DPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPTTGTGTLLLTLID VNDHGPVPEPRQITICNQSPVRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGD TVVLSLKKFLKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVETCPGPWKGGFILPVL GAVLALLFLLLVLLLLVRKKRKIKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHR GLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDTLLVF DYEGSGSDAASLSSLTSSASDQDQDYDYLNEWGSRFKKLADMYGGGEDD |
| UniProt accession: P22223 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What are the recommended applications and dilutions for the mouse anti-Human P-cadherin monoclonal antibody (NCC-CAD-299)?
This antibody is suitable for Western Blotting (WB), Immunohistochemistry (IHC), and cell contact inhibition assays. Recommended dilutions are 5-10 µg/mL for Western Blotting under non-reducing and non-heating conditions, 5-10 µg/mL for IHC on frozen tissue sections, and 100 µg/mL for cell contact inhibition assays.
How should the mouse anti-Human P-cadherin monoclonal antibody (NCC-CAD-299) be stored to maintain stability?
The lyophilized antibody is stable at 4°C for up to 2 years. After reconstitution, the antibody solution should be aliquoted and stored at -20°C for up to one year or at 4°C for 6 months if 0.1% sodium azide is added.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.