| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Calpastatin |
| available sizes | 100 µg |
mouse anti-Human Calpastatin monoclonal antibody (CSL1-5) 8619
$509.00
Antibody summary
- Mouse monoclonal to Human Calpastatin
- Suitable for: WB,ELISA
- Isotype: IgG1
- 100 µg
mouse anti-Human Calpastatin monoclonal antibody (CSL1-5) 8619
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions ELISA: 1-10ug/ml with immobilized antigen Western Blot: 1-10ug/ml, denaturing and non-denaturing conditions. Immunohistochemistry: 1-10ug/ml, frozen tissue sections. |
| Immunogen Recombinant human muscle- type calpastatin. |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product does not contain preservative. Lyophilized antibody is stable at 4°C for 2 years. Store the reconstituted solution (2. 0mg/ml) in aliquots at -20°C for one year or at 4° |
| Storage buffer 10 mM PBS, pH 7.4, 1% BSA, lyophilized |
| Purity immunogen affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens CAST Calpastatin |
| Protein names Calpastatin |
| Alternative names Calpain inhibitor, Sperm BS-17 component |
| Gene names CAST |
| Protein family Belongs to the protease inhibitor I27 (calpastatin) family |
| Function Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue |
| Post-translational modification The N-terminus is blocked |
| Involvement in disease Peeling skin with leukonychia, acral punctate keratoses, cheilitis, and knuckle pads An autosomal recessive disease characterized by generalized, continuous shedding of the outer layers of the epidermis, leukonychia, acral punctate keratosis, cheilitis, knuckle pads with multiple hyperkeratotic micropapules involving the interphalangeal joints, and palmoplantar keratoderma. |
| Keywords Acetylation, Alternative splicing, Isopeptide bond, Palmoplantar keratoderma, Phosphoprotein, Protease inhibitor, Proteomics identification, Reference proteome, Repeat, Thiol protease inhibitor, Ubl conjugation |
| Sequence MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEH TEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAI SGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGP EVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFT CGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGT RQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKP KPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPP EPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPD YRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAIS EVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAK AEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDS CPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD |
| UniProt accession: P20810 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Human Calpastatin monoclonal antibody (CSL1-5) been validated for?
This antibody has been tested and validated for use in Western Blot (WB) and ELISA applications. It is also suitable for immunocytochemistry/immunofluorescence (ICC/IF) and immunohistochemistry (IHC) on frozen tissue sections.
How should the mouse anti-Human Calpastatin monoclonal antibody be stored to maintain stability?
The lyophilized antibody is stable at 4°C for up to 2 years. After reconstitution to 2.0 mg/mL, it should be aliquoted and stored at -20°C for up to one year or at 4°C for short term use. This product does not contain preservatives.
What is the source and clonality of the anti-Calpastatin antibody CSL1-5?
The antibody is a mouse monoclonal antibody of the IgG1 isotype, generated against recombinant human muscle-type calpastatin.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.