Skip to content

mouse anti-HTLV-1 Tax monoclonal antibody (1A3) 8868

$520.00

Antibody summary

  • Mouse monoclonal to HTLV-1 Tax
  • Suitable for: WB,IHC,ELISA
  • Isotype: IgG2a
  • 100 µg
SKU: 8868parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG2a

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

HTLV-1 Tax

available sizes

100 µg

mouse anti-HTLV-1 Tax monoclonal antibody (1A3) 8868

antibody
Tested applications
WB,IHC,IHC,ELISA
Recommended dilutions
ELISA: use at 0.1-1.0ug/ml

Immunoblotting:

User should use at 2-10ug/ml. A band of ~42kDa is detected.

Immunohistochemistry: use at 2- 20ug/ml.

These are recommended concentrations.

End user should determine optimal concentrations for their applications.
Immunogen
Recombinant full-length HTLV- Tax protein.
Size and concentration
100µg and
Form
lyophilized
Storage Instructions
This product is stable for at least one (1) year at -20°C to -70°C. Reconstituted product should be stored in appropriate aliquots to avoid repeated freeze-thaw cycles.
Storage buffer
Lyophilized, 0.1M Tris, 0.1M glycine, 2% sucrose
Purity
protein affinity purification
Clonality
monoclonal
Isotype
IgG2a
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG2a - Isotype Control
target relevance
Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) TAX
Protein Tax-1
Protein names
Protein Tax-1
Alternative names
Protein X-LOR, Trans-activating transcriptional regulatory protein of HTLV-1
Gene names
Tax
Protein family
Belongs to the deltaretrovirus Tax protein family
Function
Transcriptional activator that governs the viral transcription from the 5'LTR via the recruitment of dimers of host phosphorylated CREB1. Together they bind cAMP response elements within the viral promoter and mediate high-level viral transcription (PubMed:22789739, PubMed:8970957). Increases host CREB1 O-GlcNAcylation to further increase 5'LTR transactivation (PubMed:28742148). Modulates also the expression of cellular genes leading to the deregulation of T-cell proliferation, perturbing the integrity of cell cycle checkpoints, the DNA damage response and apopototic pathways. Acts as an ubiquitin E3 ligase and stimulates host IKK complex by catalyzing the assembly of free mixed-linkage polyubiquitin chains, resulting in constitutive activation of the transcription factor NF-kappa-B (PubMed:27082114, PubMed:28103322). Inhibits the host nonsense-mediated mRNA decay (NMD), a cellular process that can actively degrade mRNAs by interacting with host UPF1 (PubMed:27082114)
Subcellular location
Host nucleus, Host cytoplasm
Structure
Homodimer. Interacts with host CREB1 (PubMed:8970957). Interacts with host DLG1, IKBKG, KDM4A, MAGII3 and TAX1BP1. Recruits the coactivators CREBBP, EP300 and PCAF (PubMed:10766811). Interaction with human CARM1 enhances Tax transactivation and promotes methylation of histone H3 (PubMed:17005681). Interacts with host SUV39H1 protein, leading to abrogate Tax transactivation of HTLV-1 LTR (PubMed:16409643). Interaction with human CREB coactivators, CRTC1/TORC1, CRTC2/TORC2 and CRTC3/TORC3 enhances Tax transactivation (PubMed:15466468, PubMed:16809310). Interacts with host UPF1; this interaction inhibits the host nonsense-mediated mRNA decay (NMD). Interacts (via N-terminus) with host PLSCR1; this interaction negatively regulates Tax transactivation activity by altering its subcellular distribution and homodimerization (PubMed:22789739)
Post-translational modification
Phosphorylation at Thr-48 results in the loss of NF-kappa-B activation function. Phosphorylation at Thr-215 results in loss of CREB and NF-B responsive promoters activation. Phosphorylation at Thr-184 and Ser-336 have no effect on these Tax functions. Phosphorylation of either Ser-300 or Ser-301 is necessary for localization to nuclear bodies. Thr-48, Thr-184, Thr-215 and Ser-336 are highly phosphorylated, whereas Ser-300 or Ser-301 are only rarely phosphorylated
Modified by host ubiquitin related modifier 1/URM1, resulting in a redistribution of Tax to the cytoplasm
Keywords
3D-structure, Activation of host NF-kappa-B by virus, Activator, DNA-binding, G0/G1 host cell cycle checkpoint dysregulation by virus, G1/S host cell cycle checkpoint dysregulation by virus, Host cytoplasm, Host nucleus, Host-virus interaction, Inhibition of host mitotic exit by virus, Metal-binding, Modulation of host cell cycle by virus, Oncogene, Phosphoprotein, SH3-binding, Transcription, Transcription regulation, Zinc, Zinc-finger
Sequence
MAHFPGFGQSLLFGYPVYVFGDCVQGDWCPISGGLCSARLHRHALLATCPEHQITWDPID GRVIGSALQFLIPRLPSFPTQRTSKTLKVLTPPITHTTPNIPPSFLQAMRKYSPFRNGYM EPTLGQHLPTLSFPDPGLRPQNLYTLWGGSVVCMYLYQLSPPITWPLLPHVIFCHPGQLG AFLTNVPYKRIEELLYKISLTTGALIILPEDCLPTTLFQPARAPVTLTAWQNGLLPFHST LTTPGLIWTFTDGTPMISGPCPKDGQPSLVLQSSSFIFHKFQTKAYHPSFLLSHGLIQYS SFHSLHLLFEEYTNIPISLLFNEKEADDNDHEPQISPGGLEPPSEKHFRETEV
UniProt accession: P03409

Data

No results found

FAQ & Publications

Frequently Asked Questions
What applications has the mouse anti-HTLV-1 Tax monoclonal antibody (1A3) been tested for?
This antibody has been validated for use in Western Blot (WB), Immunohistochemistry (IHC), and ELISA applications.
How should the mouse anti-HTLV-1 Tax monoclonal antibody (1A3) be stored to maintain its stability?
The antibody is stable for at least one year when stored lyophilized at temperatures between -20°C and -70°C. Once reconstituted, it should be aliquoted and stored to avoid repeated freeze-thaw cycles.
What is the recommended concentration range for using this antibody in ELISA and immunoblotting assays?
For ELISA, use the antibody at 0.1 to 1.0 µg/mL. For immunoblotting, a concentration between 2 and 10 µg/mL is recommended, with detection of a band at approximately 42 kDa.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.