Skip to content

mouse anti-Factor XIIIa monoclonal antibody (ZM84) 6181

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to Factor XIIIa
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG2a
  • Control: Capillary hemangioma, dermatofibroma, and placenta
  • Visualization: Cytoplasmic and nuclear
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6181parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG2a

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Factor XIIIa monoclonal antibody ZM84 6181

antibody
Database link:
human P21980
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Capillary hemangioma, dermatofibroma, and placenta
Immunogen
Recombinant fragment of human Factor XIIIa protein
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG2a
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG2a - Isotype Control
target relevance
Homo sapiens TGM2
Protein-glutamine gamma-glutamyltransferase 2
Protein names
Protein-glutamine gamma-glutamyltransferase 2
Alternative names
Erythrocyte transglutaminase, Heart G alpha(h), Isopeptidase TGM2, Protein G alpha(h), Protein-glutamine deamidase TGM2, Protein-glutamine dopaminyltransferase TGM2, Protein-glutamine histaminyltransferase TGM2, Protein-glutamine noradrenalinyltransferase TGM2, Protein-glutamine serotonyltransferase TGM2, Tissue transglutaminase, Transglutaminase C, Transglutaminase H, Transglutaminase II, Transglutaminase-2
Gene names
TGM2
Protein family
Belongs to the transglutaminase superfamily. Transglutaminase family
Function
Calcium-dependent acyltransferase that catalyzes the formation of covalent bonds between peptide-bound glutamine and various primary amines, such as gamma-amino group of peptide-bound lysine, or mono- and polyamines, thereby producing cross-linked or aminated proteins, respectively (PubMed:23941696, PubMed:31991788, PubMed:9252372). Involved in many biological processes, such as bone development, angiogenesis, wound healing, cellular differentiation, chromatin modification and apoptosis (PubMed:1683874, PubMed:27270573, PubMed:28198360, PubMed:7935379, PubMed:9252372). Acts as a protein-glutamine gamma-glutamyltransferase by mediating the cross-linking of proteins, such as ACO2, HSPB6, FN1, HMGB1, RAP1GDS1, SLC25A4/ANT1, SPP1 and WDR54 (PubMed:23941696, PubMed:24349085, PubMed:29618516, PubMed:30458214). Under physiological conditions, the protein cross-linking activity is inhibited by GTP; inhibition is relieved by Ca(2+) in response to various stresses (PubMed:18092889, PubMed:7592956, PubMed:7649299). When secreted, catalyzes cross-linking of proteins of the extracellular matrix, such as FN1 and SPP1 resulting in the formation of scaffolds (PubMed:12506096). Plays a key role during apoptosis, both by (1) promoting the cross-linking of cytoskeletal proteins resulting in condensation of the cytoplasm, and by (2) mediating cross-linking proteins of the extracellular matrix, resulting in the irreversible formation of scaffolds that stabilize the integrity of the dying cells before their clearance by phagocytosis, thereby preventing the leakage of harmful intracellular components (PubMed:7935379, PubMed:9252372). In addition to protein cross-linking, can use different monoamine substrates to catalyze a vast array of protein post-translational modifications: mediates aminylation of serotonin, dopamine, noradrenaline or histamine into glutamine residues of target proteins to generate protein serotonylation, dopaminylation, noradrenalinylation or histaminylation, respectively (PubMed:23797785, PubMed:30867594). Mediates protein serotonylation of small GTPases during activation and aggregation of platelets, leading to constitutive activation of these GTPases (By similarity). Plays a key role in chromatin organization by mediating serotonylation and dopaminylation of histone H3 (PubMed:30867594, PubMed:32273471). Catalyzes serotonylation of 'Gln-5' of histone H3 (H3Q5ser) during serotonergic neuron differentiation, thereby facilitating transcription (PubMed:30867594). Acts as a mediator of neurotransmission-independent role of nuclear dopamine in ventral tegmental area (VTA) neurons: catalyzes dopaminylation of 'Gln-5' of histone H3 (H3Q5dop), thereby regulating relapse-related transcriptional plasticity in the reward system (PubMed:32273471). Regulates vein remodeling by mediating serotonylation and subsequent inactivation of ATP2A2/SERCA2 (By similarity). Also acts as a protein deamidase by mediating the side chain deamidation of specific glutamine residues of proteins to glutamate (PubMed:20547769, PubMed:9623982). Catalyzes specific deamidation of protein gliadin, a component of wheat gluten in the diet (PubMed:9623982). May also act as an isopeptidase cleaving the previously formed cross-links (PubMed:26250429, PubMed:27131890). Also able to participate in signaling pathways independently of its acyltransferase activity: acts as a signal transducer in alpha-1 adrenergic receptor-mediated stimulation of phospholipase C-delta (PLCD) activity and is required for coupling alpha-1 adrenergic agonists to the stimulation of phosphoinositide lipid metabolism (PubMed:8943303)
Catalytic activity
L-glutaminyl-[protein] + L-lysyl-[protein] = [protein]-L-lysyl-N(6)-5-L-glutamyl-[protein] + NH4(+)
L-glutaminyl-[protein] + serotonin = 5-serotonyl-L-glutamyl-[protein] + NH4(+)
L-glutaminyl-[protein] + dopamine = 5-dopaminyl-L-glutamyl-[protein] + NH4(+)
L-glutaminyl-[protein] + histamine = 5-histaminyl-L-glutamyl-[protein] + NH4(+)
L-glutaminyl-[protein] + (R)-noradrenaline = 5-(R)-noradrenalinyl-L-glutamyl-[protein] + NH4(+)
L-glutaminyl-[protein] + H2O = L-glutamyl-[protein] + NH4(+)
Subcellular location
Cytoplasm, perinuclear region
Structure
Homooligomer
Post-translational modification
Disulfide bond formation inactivates the calcium-dependent acyltransferase activity (PubMed:20547769). Cys-370 can form disulfide bonds with both Cys-230 and Cys-371: formation of a disulfide bond between Cys-230 and Cys-370 facilitates formation of the disulfide between Cys-370 and Cys-371, which promotes inactivation of the acyltransferase activity (PubMed:20547769). May also form interchain disulfids between Cys-230 and Cys-370 (PubMed:25192068). Ca(2+) protects against disulfide bond formation and inactivation (PubMed:20547769)
Auto-transglutaminated: Forms covalent cross-links mediated by transglutaminase between Gln-633 and the epsilon-amino group of a lysine residue of itself or HMGB1, forming homopolymers and heteropolymers, respectively
S-nitrosylated, leading to inactivation of the acyltransferase activity
Keywords
3D-structure, Acetylation, Acyltransferase, Alternative splicing, Calcium, Cell membrane, Chromosome, Cytoplasm, Direct protein sequencing, Disulfide bond, Extracellular matrix, GTP-binding, Hydrolase, Isopeptide bond, Membrane, Metal-binding, Mitochondrion, Nucleotide-binding, Nucleus, Phosphoprotein, Protease, Proteomics identification, Reference proteome, S-nitrosylation, Secreted, Transferase
Sequence
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG LHKLVVNFESDKLKAVKGFRNVIIGPA
UniProt accession: P21980

Data

Human neuroblastoma stained with anti-Factor XIIIa antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of fibroblasts and macrophages.
Human neuroblastoma stained with anti-Factor XIIIa antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of fibroblasts and macrophages.

FAQ & Publications

Frequently Asked Questions
What applications is the mouse anti-Factor XIIIa monoclonal antibody (ZM84) suitable for?
This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.
How should the mouse anti-Factor XIIIa antibody be stored for optimal stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, freeze at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.
What species does the mouse anti-Factor XIIIa monoclonal antibody (ZM84) react with?
This antibody specifically reacts with human Factor XIIIa protein.
What is the recommended dilution for using the concentrated form of this antibody in IHC?
The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.
What are the available sizes and concentrations for the mouse anti-Factor XIIIa monoclonal antibody (ZM84)?
The antibody is available in 0.1 mL, 0.5 mL, and 1.0 mL concentrated formats, as well as a 7 mL prediluted format.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.