| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2b |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Estrogen Receptor β |
| available sizes | 100 µg |
mouse anti-Estrogen Receptor beta monoclonal antibody (6A12) 8974
$503.00
Antibody summary
- Mouse monoclonal to Estrogen Receptor beta
- Suitable for: WB,ICC/IF,ChIP,IHC
- Isotype: IgG2b
- 100 µg
mouse anti-Estrogen Receptor beta monoclonal antibody (6A12) 8974
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,IP,ChIP |
| Recommended dilutions Immunoblotting: use at 1-5 ug/mL. Positive controls: Native receptor from human thymus, spleen, ovary, and testis or recombinant protein. |
| Immunogen 6-His fusion protein containing the region encoding aa 1-153 of human estrogen receptor-b (ER-b) expressed in E. coli. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4 |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG2b |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2b - Isotype Control |
| target relevance |
|---|
| Homo sapiens ESR2 Estrogen receptor beta |
| Protein names Estrogen receptor beta |
| Alternative names Nuclear receptor subfamily 3 group A member 2 |
| Gene names ESR2 |
| Protein family Belongs to the nuclear hormone receptor family. NR3 subfamily |
| Function Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1/ER-alpha, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560) |
| Subcellular location Nucleus |
| Structure Preferentially forms a heterodimer with ESR1 rather than ESR2 isoform 1 and inhibits DNA-binding by ESR1 |
| Post-translational modification Phosphorylation at Ser-87 and Ser-105 recruits NCOA1 |
| Involvement in disease Ovarian dysgenesis 8 An autosomal dominant form of ovarian dysgenesis, a disorder characterized by lack of spontaneous pubertal development, primary amenorrhea, uterine hypoplasia, and hypergonadotropic hypogonadism as a result of streak gonads. |
| Keywords 3D-structure, Activator, Alternative splicing, Disease variant, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Steroid-binding, Transcription, Transcription regulation, Zinc, Zinc-finger |
| Sequence MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ |
| UniProt accession: Q92731 |
Data
 |
| Non-transfected (-) and transfected (-) 293T whole cell extracts (30 µg) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Estrogen Receptor beta antibody [6A12] (8974) diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody. |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-Estrogen Receptor beta monoclonal antibody (6A12) validated for?
This antibody is validated for multiple applications including Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry/Immunofluorescence (ICC/IF), Immunoprecipitation (IP), and Chromatin Immunoprecipitation (ChIP). Recommended dilution for immunoblotting is 1-5 µg/mL.
How should the mouse anti-Estrogen Receptor beta monoclonal antibody be stored to maintain stability?
The antibody should be stored at -70°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.