| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Epidermal Growth Factor-like Protein 7 |
| available sizes | 100 µg |
mouse anti-Epidermal Growth Factor-like Protein 7 monoclonal antibody (2H2) 7301
$520.00
Antibody summary
- Mouse monoclonal to Epidermal Growth Factor-like Protein 7
- Suitable for: WB,IHC,ELISA
- Isotype: IgG1
- 100 µg
mouse anti-Epidermal Growth Factor-like Protein 7 monoclonal antibody (2H2) 7301
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions ELISA: use at 1-10ug/ml Immunoblotting: User should use at 1-5ug/ml. A band of ~30kDa is detected. Immunohistochemistry: Use at 2- 10ug/ml. These are recommended concentrations. End user should determine optimal concentrations for their applications. |
| Immunogen His-tagged EGFL-7 recombinant protein. Accession no. Q9UHF1. |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product is stable for at least one (1) year at -20°C to -70°C. Reconstituted product should be stored in appropriate aliquots to avoid repeated freeze-thaw cycles. |
| Storage buffer Lyophilized, 0.1M Tris, 0.1M glycine, 2% sucrose |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens EGFL7 Epidermal growth factor-like protein 7 |
| Protein names Epidermal growth factor-like protein 7 |
| Alternative names Multiple epidermal growth factor-like domains protein 7, NOTCH4-like protein, Vascular endothelial statin, Zneu1 |
| Gene names EGFL7 |
| Function Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis |
| Subcellular location Secreted, extracellular space |
| Structure Interacts with ITGAV/ITGB3 in an RGD-dependent manner, increasing endothelial cell's motility |
| Keywords Angiogenesis, Calcium, Cell adhesion, Coiled coil, Developmental protein, Differentiation, Disulfide bond, EGF-like domain, Proteomics identification, Reference proteome, Repeat, Secreted, Signal |
| Sequence MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS |
| UniProt accession: Q9UHF1 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-EGFL7 monoclonal antibody (2H2) been tested for?
This antibody has been tested and is suitable for Western blotting (WB), immunohistochemistry (IHC), and enzyme-linked immunosorbent assay (ELISA). Recommended dilutions are 1-5 µg/mL for Western blot, 2-10 µg/mL for immunohistochemistry, and 1-10 µg/mL for ELISA.
How should the mouse anti-EGFL7 antibody be stored to maintain stability?
The lyophilized antibody is stable for at least one year when stored at -20°C to -70°C. After reconstitution, it should be aliquoted and stored appropriately to avoid repeated freeze-thaw cycles.
What is the immunogen used to generate this monoclonal antibody against EGFL7?
The immunogen is a His-tagged recombinant Epidermal Growth Factor-like Protein 7 (EGFL7). The UniProt accession number for this protein is Q9UHF1.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.