Immunohistochemistry (IHC) : Human colon adenocarcinoma stained with MOC-31 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of tumor cells.

mouse anti-EP-CAM/ ESA monoclonal antibody (MOC-31) 8172

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to EP-CAM/ ESA
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Colon carcinoma
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 8172parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, EP-CAM, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-EP-CAM/ ESA monoclonal antibody MOC-31 8172

antibody
Database link: human P16422
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Colon carcinoma
Immunogen Neuraminidase treated GLS-1 human small cell lung carcinoma cells
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens EPCAM Epithelial cell adhesion molecule
Protein names Epithelial cell adhesion molecule
Alternative names Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1
Gene names EPCAM
Protein family Belongs to the EPCAM family
Function May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E
Subcellular location Lateral cell membrane, Cell junction, tight junction
Structure Monomer. Interacts with phosphorylated CLDN7
Post-translational modification Hyperglycosylated in carcinoma tissue as compared with autologous normal epithelia. Glycosylation at Asn-198 is crucial for protein stability
Involvement in disease Diarrhea 5, with tufting enteropathy, congenital An intractable diarrhea of infancy characterized by villous atrophy and absence of inflammation, with intestinal epithelial cell dysplasia manifesting as focal epithelial tufts in the duodenum and jejunum. Lynch syndrome 8 A form of Lynch syndrome, an autosomal dominant disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early-onset colorectal carcinoma (CRC) and extra-colonic tumors of the gastrointestinal, urological and female reproductive tracts. Lynch syndrome is reported to be the most common form of inherited colorectal cancer in the Western world. Clinically, it is often divided into two subgroups. Type I is characterized by hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II is characterized by increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical Lynch syndrome is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected Lynch syndrome' or 'incomplete Lynch syndrome' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected.
Keywords 3D-structure, Cell junction, Cell membrane, Direct protein sequencing, Disease variant, Disulfide bond, Glycoprotein, Hereditary nonpolyposis colorectal cancer, Membrane, Proteomics identification, Reference proteome, Repeat, Signal, Tight junction, Transmembrane, Transmembrane helix, Tumor antigen
Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA EIKEMGEMHRELNA
UniProt accession: P16422

Data

Human colon adenocarcinoma stained with MOC-31 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended application for the mouse anti-EP-CAM/ESA monoclonal antibody (MOC-31)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

Which species does the MOC-31 antibody specifically react with?

The mouse anti-EP-CAM/ESA monoclonal antibody (MOC-31) is reactive with human tissues.

How should the MOC-31 antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze at -20°C while avoiding repeated freeze/thaw cycles.

What is the host and clonality of the anti-EP-CAM/ESA antibody with catalog number 8172?

The antibody is a mouse monoclonal IgG1 antibody.

What is the positive control tissue recommended for validating staining with the MOC-31 antibody?

Colon carcinoma tissue is recommended as a positive control for this antibody in immunohistochemistry.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.