| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DNA Ligase I |
| available sizes | 100 µg |
mouse anti-DNA Ligase I monoclonal antibody (10H5) 2446
$503.00
Antibody summary
- Mouse monoclonal to DNA Ligase I
- Suitable for: WB,ICC/IF,IHC-P,IP
- Isotype: IgG1
- 100 µg
mouse anti-DNA Ligase I monoclonal antibody (10H5) 2446
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF |
| Recommended dilutions Immunoblotting: use at 1-5 ug/mL. Immunoprecipitation: use at 1-5 ug/mL. Positive controls: MCF-7 cells or recombinant protein. |
| Immunogen Recombinant human DNA Ligase I (aa 1-919) purified from baculovirus infected Sf9 cells. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4 |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens LIG1 DNA ligase 1 |
| Protein names DNA ligase 1 |
| Alternative names DNA ligase I, Polydeoxyribonucleotide synthase [ATP] 1 |
| Gene names LIG1 |
| Protein family Belongs to the ATP-dependent DNA ligase family |
| Function DNA ligase that seals nicks in double-stranded during DNA repair (PubMed:30395541). Also involved in DNA replication and DNA recombination |
| Catalytic activity ATP + (deoxyribonucleotide)n-3'-hydroxyl + 5'-phospho-(deoxyribonucleotide)m = (deoxyribonucleotide)n+m + AMP + diphosphate. |
| Subcellular location Nucleus |
| Structure Interacts with PCNA (PubMed:24911150). Interacts with POLB (PubMed:19336415) |
| Involvement in disease Immunodeficiency 96 An autosomal recessive disorder characterized by onset of recurrent, usually viral, respiratory infections in infancy or early childhood. Other infections, including gastrointestinal and urinary tract infections, may also occur. Laboratory studies show hypogammaglobulinemia, lymphopenia with increased gamma/delta T cells, and erythrocyte macrocytosis. |
| Keywords 3D-structure, Acetylation, Alternative splicing, ATP-binding, Cell cycle, Cell division, Disease variant, DNA damage, DNA recombination, DNA repair, DNA replication, Ligase, Magnesium, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA ARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPK RRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQ PTTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVK KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAM VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL KPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCE GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ SQIQNQQGEDSGSDPEDTY |
| UniProt accession: P18858 |
Data
 |
| Various whole cell extracts (30 µg) were separated by 5% SDS-PAGE, and the membrane was blotted with DNA ligase I antibody [10H5] (2446) diluted at 1:2000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody. |
 |
| DNA ligase I antibody [10H5] detects DNA ligase I protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: DNA ligase I stained by DNA ligase I antibody [10H5] (2446) diluted at 1:500.Red: phalloidin, a cytoskeleton marker, diluted at 1:200.Scale bar= 10 um. |
 |
| DNA ligase I antibody [10H5] detects DNA ligase I protein at nucleus by immunohistochemical analysis.Sample: Paraffin-embedded human breast carcinoma.DNA ligase I stained by DNA ligase I antibody [10H5] (2446) diluted at 1:100.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-DNA Ligase I monoclonal antibody (10H5) been tested for?
This antibody has been validated for use in Western blotting (WB), immunohistochemistry (IHC), immunocytochemistry/immunofluorescence (ICC/IF), and immunoprecipitation (IP).
What is the recommended storage condition for this antibody to maintain its stability?
The antibody should be stored at -70°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the source and clonality of the anti-DNA Ligase I antibody (10H5)?
This antibody is a mouse monoclonal antibody of the IgG1 isotype, generated against recombinant human DNA Ligase I protein.
Which secondary antibodies are compatible for detection when using this mouse anti-DNA Ligase I monoclonal antibody?
Compatible secondary antibodies include goat anti-mouse IgG (H&L chain specific) conjugated to peroxidase, biotin, or FITC, including cross-absorbed versions to reduce non-specific binding.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.