| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Cytokine Receptor-like Factor 2 |
| available sizes | 100 µg |
mouse anti-Cytokine Receptor-Like Factor 2 monoclonal antibody (8H8) 3284
$520.00
Antibody summary
- Mouse monoclonal to Cytokine Receptor-Like Factor 2
- Suitable for: WB,IHC,ELISA
- Isotype: IgG1
- 100 µg
mouse anti-Cytokine Receptor-Like Factor 2 monoclonal antibody (8H8) 3284
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions ELISA: use at 0.05-0.10ug/ml. Immunoblotting: use at 0.5-1ug/ml. A band of ~42kDa is detected. Immunohistochemistry: Formalin-fixed, paraffin-embedded tissue. Use at 1- 10ug/ml. These are recommended concentrations. Enduser should determine optimal concentrations fo |
| Immunogen Recombinant human TSLPR- Fc fusion protein. Accession no. Q9HC73. |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product is stable for at least one (1) year at -20°C to -70°C. Reconstituted product should be stored in appropriate aliquots to avoid repeated freeze-thaw cycles. |
| Storage buffer Lyophilized, 0.1M Tris, 0.1M glycine, 2% sucrose |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens CRLF2 Cytokine receptor-like factor 2 |
| Protein names Cytokine receptor-like factor 2 |
| Alternative names Cytokine receptor-like 2, IL-XR, Thymic stromal lymphopoietin protein receptor |
| Gene names CRLF2 |
| Protein family Belongs to the type I cytokine receptor family. Type 5 subfamily |
| Function Receptor for thymic stromal lymphopoietin (TSLP). Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2 (By similarity). Implicated in the development of the hematopoietic system |
| Subcellular location Secreted |
| Structure Heterodimer of CRLF2 and IL7R |
| Keywords 3D-structure, Alternative splicing, Cell membrane, Disulfide bond, Glycoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Secreted, Signal, Transmembrane, Transmembrane helix |
| Sequence MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHY RFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPS SPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKC YSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKFILISSLAI LLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQGNFQEWITDTQNVAHLHKMA GAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGGDVVTIGGFT FVMNDRSYVAL |
| UniProt accession: Q9HC73 |
Data
 |
| Immunohistochemistry: Formalin-fixed, paraffin-embedded tissue. Use at 110ug/ml. Staining of human thymus with #3284. |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Cytokine Receptor-Like Factor 2 monoclonal antibody (8H8) been validated for?
This monoclonal antibody has been tested and validated for use in Western blotting (WB), immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, and ELISA assays.
How should the mouse anti-Cytokine Receptor-Like Factor 2 antibody (8H8) be stored to maintain stability?
The antibody should be stored lyophilized at temperatures between -20°C and -70°C where it remains stable for at least one year. Once reconstituted, it should be aliquoted appropriately to avoid repeated freeze-thaw cycles.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.