| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | CYFRA21-1 |
| available sizes | 200 µg |
mouse anti-CYFRA21-1 monoclonal antibody (1X3) 4016
$324.00
Antibody summary
- Mouse monoclonal to CYFRA21-1
- Suitable for: ELISA
- Isotype: IgG1
- 200 µg
mouse anti-CYFRA21-1 monoclonal antibody (1X3) 4016
| antibody |
|---|
| Tested applications ELISA |
| Recommended dilutions ELISA: for sandwich ELISA, use #34082 as capture antibody and #34083 as detection antibody. End users should determine optimal antibody concentrations for their applications. |
| Immunogen Soluble cytokeratin fraction purified from a human cell line |
| Size and concentration 200µg and lot specific |
| Form liquid |
| Storage Instructions Store product at 4°C. |
| Storage buffer PBS, pH 7.4, 0.09% NaN3. |
| Purity ion exchange |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens KRT19 Keratin, type I cytoskeletal 19 |
| Protein names Keratin, type I cytoskeletal 19 |
| Alternative names Cytokeratin-19, Keratin-19 |
| Gene names KRT19 |
| Protein family Belongs to the intermediate filament family |
| Function Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle |
| Structure (Microbial infection) Interacts with hepatitis C virus/HCV core protein |
| Keywords 3D-structure, Coiled coil, Direct protein sequencing, Host-virus interaction, Intermediate filament, Keratin, Methylation, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL |
| UniProt accession: P08727 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-CYFRA21-1 monoclonal antibody (1X3) suitable for?
This antibody is suitable for ELISA, as well as immunocytochemistry/immunofluorescence (ICC/IF) and Western blotting (WB) applications.
How should the mouse anti-CYFRA21-1 monoclonal antibody be stored to maintain stability?
The product should be stored at 4°C in its storage buffer, which consists of PBS pH 7.4 with 0.09% sodium azide (NaN3).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.