| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Clostridium botulinum Toxin D |
| available sizes | 25 µg |
mouse anti-Clostridium botulinum Toxin D monoclonal antibody (5131) 7053
$469.00
Antibody summary
- Mouse monoclonal to Clostridium botulinum Toxin D
- Suitable for: ICC/IF,ELISA
- Isotype: IgG1
- 25 µg
mouse anti-Clostridium botulinum Toxin D monoclonal antibody (5131) 7053
| antibody |
|---|
| Tested applications ICC/IF,ELISA |
| Recommended dilutions ELISA: use a dilution of 1:20-1:200. Immunocytochemistry/ Immunohistochemistry: use a dilution of 1:10-1:50. Immunofluorescence: use a dilution of 1:10-1:50 Immunoblotting: use a dilution of 1:100-1:1,000. A band of ~150,000 is detected. End users should determine op |
| Immunogen Toxin D purified from culture filtrate of C. botulinum. |
| Size and concentration 25µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable at 4°C for short-term storage and for at least one (1) year at -20° to -70°C. Store product in appropriate aliquots to avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.2, 0.1% NaN3. |
| Purity immunogen affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Clostridium botulinum D phage BOTD Botulinum neurotoxin type D |
| Protein names Botulinum neurotoxin type D |
| Alternative names Bontoxilysin-D |
| Gene names botD |
| Protein family Belongs to the peptidase M27 family |
| Function Botulinum toxin causes flaccid paralysis by inhibiting neurotransmitter (acetylcholine) release from the presynaptic membranes of nerve terminals of the eukaryotic host skeletal and autonomic nervous system, with frequent heart or respiratory failure (PubMed:16252491, PubMed:8175689). Precursor of botulinum neurotoxin D for which a proteinaceous coreceptor is controversial. In double SV2A/SV2B knockout mice this toxin does not degrade its synaptobrevin target; introducing SV2A, SV2B or SV2C restores target cleavage (PubMed:21483489). Recognition of SV2 by this toxin does not occur via SV2 glycosylation or its large extracellular loop 4 (PubMed:21483489). Another group does not find a convincing interaction with SV2 (PubMed:21632541). Thus a protein receptor for this BoNT serotype has yet to be definitively proven. Recognizes at least 1 complex polysialylated ganglioside found on neural tissue. Electrical stimulation increases uptake of toxin in an ex vivo assay, presumably by transiently exposing a receptor usually found in eukaryotic target synaptic vesicles (PubMed:19650874, PubMed:21483489, PubMed:21632541). Upon synaptic vesicle recycling the toxin is taken up via the endocytic pathway; when the pH of the toxin-containing endosome drops a structural rearrangement occurs so that the N-terminus of the heavy chain (HC) forms pores that allows the light chain (LC) to translocate into the cytosol (By similarity). Once in the cytosol the disulfide bond linking the 2 subunits is reduced and LC cleaves its target protein on synaptic vesicles, preventing their fusion with the cytoplasmic membrane and thus neurotransmitter release (By similarity). Requires complex eukaryotic host polysialogangliosides for full neurotoxicity and for binding to neurons (PubMed:20704566, PubMed:21483489) |
| Catalytic activity Limited hydrolysis of proteins of the neuroexocytosis apparatus, synaptobrevins, SNAP25 or syntaxin. No detected action on small molecule substrates. |
| Subcellular location Secreted |
| Structure Heterodimer; disulfide-linked heterodimer of a light chain (LC) and a heavy chain (HC) (PubMed:26324071). The LC has the proteolytic/pharmacological activity (PubMed:8175689, PubMed:8197120). The N- and C-termini of the HC mediate channel formation and eukaryotic host cell binding, respectively. Can also be purified in complex with a non-toxic component that is larger than the HC (PubMed:16252491). Single chain toxin from strain D-4947 copurifies with NTHNA, and in complexes that include NTNHA, HA-70, HA-33 and HA-17 (PubMed:11713244, PubMed:17581814). Dichain toxin from strain CB-16 phage d-16 phi copurifies with NTHNA, and in complexes that include NTNHA, HA-55, HA-33, HA-22 and HA-17 (PubMed:8569530). The stoichiometry of the whole complex has been modeled as one BoNT/D, one NTNHA, three HA-70, six HA-33 and three HA-17 (PubMed:17581814). HC interacts with eukaryotic protein synaptic vesicle glycoprotein 2B (SV2B), which may serve as its receptor (PubMed:21483489). Another group does not find a convincing interaction with SV2 (PubMed:21632541) |
| Keywords 3D-structure, Direct protein sequencing, Disulfide bond, Hydrolase, Lipid-binding, Metal-binding, Metalloprotease, Neurotoxin, Protease, Secreted, Toxin, Virulence, Zinc |
| Sequence MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSK PPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDS STPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSN PSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYG INIPSDKRIRPQVSEGFFSQDGPNVQFEELYTFGGLDVEIIPQIERSQLREKALGHYKDI AKRLNNINKTIPSSWISNIDKYKKIFSEKYNFDKDNTGNFVVNIDKFNSLYSDLTNVMSE VVYSSQYNVKNRTHYFSRHYLPVFANILDDNIYTIRDGFNLTNKGFNIENSGQNIERNPA LQKLSSESVVDLFTKVCLRLTKNSRDDSTCIKVKNNRLPYVADKDSISQEIFENKIITDE TNVQNYSDKFSLDESILDGQVPINPEIVDPLLPNVNMEPLNLPGEEIVFYDDITKYVDYL NSYYYLESQKLSNNVENITLTTSVEEALGYSNKIYTFLPSLAEKVNKGVQAGLFLNWANE VVEDFTTNIMKKDTLDKISDVSVIIPYIGPALNIGNSALRGNFNQAFATAGVAFLLEGFP EFTIPALGVFTFYSSIQEREKIIKTIENCLEQRVKRWKDSYQWMVSNWLSRITTQFNHIN YQMYDSLSYQADAIKAKIDLEYKKYSGSDKENIKSQVENLKNSLDVKISEAMNNINKFIR ECSVTYLFKNMLPKVIDELNKFDLRTKTELINLIDSHNIILVGEVDRLKAKVNESFENTM PFNIFSYTNNSLLKDIINEYFNSINDSKILSLQNKKNALVDTSGYNAEVRVGDNVQLNTI YTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDLTNSHNEYTIINSIEQNS GWKLCIRNGNIEWILQDVNRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMKLYIN GELKQSQKIEDLDEVKLDKTIVFGIDENIDENQMLWIRDFNIFSKELSNEDINIVYEGQI LRNVIKDYWGNPLKFDTEYYIINDNYIDRYIAPESNVLVLVQYPDRSKLYTGNPITIKSV SDKNPYSRILNGDNIILHMLYNSRKYMIIRDTDTIYATQGGECSQNCVYALKLQSNLGNY GIGIFSIKNIVSKNKYCSQIFSSFRENTMLLADIYKPWRFSFKNAYTPVAVTNYETKLLS TSSFWKFISRDPGWVE |
| UniProt accession: P19321 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Clostridium botulinum Toxin D monoclonal antibody (5131) been validated for?
This antibody has been tested and validated for use in Immunocytochemistry/Immunofluorescence (ICC/IF) and ELISA applications.
How should the mouse anti-Clostridium botulinum Toxin D monoclonal antibody be stored to maintain stability?
The antibody is stable for short-term storage at 4°C and can be stored for at least one year at temperatures between -20°C and -70°C. It is recommended to aliquot the product to avoid repeated freeze-thaw cycles.
What is the host species and isotype of the anti-Clostridium botulinum Toxin D monoclonal antibody?
The antibody is a mouse monoclonal antibody of the IgG1 isotype.
What is the immunogen used to generate this monoclonal antibody against Clostridium botulinum Toxin D?
The immunogen used is purified Toxin D obtained from the culture filtrate of Clostridium botulinum.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.