| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | subunit |
| isotype | IgG |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Cholera Toxin β Subunit |
| available sizes | 200 µg |
anti-Cholera toxin beta subunit monoclonal antibody 4857
$314.00
Antibody summary
- subunit monoclonal to Cholera toxin beta subunit
- Suitable for: ELISA
- Isotype: Whole IgG
- 200 µg
anti-Cholera toxin beta subunit monoclonal antibody 4857
| antibody |
|---|
| Tested applications ELISA |
| Size and concentration 200µg and lot specific |
| Form liquid |
| Storage Instructions Store at 2 - 8µC. Do not Freeze. |
| Storage buffer PBS, 1mg/ml BSA, 0.02% NaN3. |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG2b |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2b - Isotype Control |
| target relevance |
|---|
| Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) CTXB Cholera enterotoxin subunit B |
| Protein names Cholera enterotoxin subunit B |
| Alternative names Cholera enterotoxin B chain, Cholera enterotoxin gamma chain, Choleragenoid |
| Gene names ctxB |
| Function The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself |
| Subcellular location Secreted, Host cell membrane |
| Structure The holotoxin (choleragen) consists of a pentameric ring of B subunits whose central pore is occupied by the A subunit. The A subunit contains two chains, A1 and A2, linked by a disulfide bridge |
| Keywords 3D-structure, Direct protein sequencing, Disulfide bond, Enterotoxin, Host cell membrane, Host membrane, Membrane, Reference proteome, Secreted, Signal, Toxin, Virulence |
| Sequence MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAI ITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAI SMAN |
| UniProt accession: P01556 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Cholera toxin beta subunit monoclonal antibody 4857 been validated for?
This monoclonal antibody has been tested and validated for ELISA, as well as applications including immunocytochemistry/immunofluorescence (ICC/IF) and Western blotting (WB).
What is the recommended storage condition for this anti-Cholera toxin beta subunit antibody?
The antibody should be stored refrigerated at 2 to 8 degrees Celsius and should not be frozen to maintain its stability and activity.
What is the isotype and clonality of the anti-Cholera toxin beta subunit monoclonal antibody 4857?
This product is a monoclonal antibody of the IgG2b isotype.
Which secondary antibodies are compatible with the mouse anti-Cholera toxin beta subunit monoclonal antibody 4857 for detection?
Compatible secondary antibodies include goat anti-mouse IgG, H&L chain specific, available conjugated with peroxidase, biotin, or FITC, including cross-absorbed variants to reduce cross-reactivity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.