Skip to content

mouse anti-Cardiac Troponin I monoclonal antibody (8E10) 5478

$235.00

Antibody summary

  • Mouse monoclonal to Cardiac Troponin I
  • Suitable for: WB,ELISA
  • Isotype: IgG2a
  • 100 µg
SKU: 5478parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG2a

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

Cardiac Troponin I

available sizes

100 µg

mouse anti-Cardiac Troponin I monoclonal antibody (8E10) 5478

antibody
Tested applications
WB,ELISA
Recommended dilutions
These antibodies may be used in immunoassays and Western blots to detect and quantitate human cardiac troponin I. They may also be used to affinity purify cardiac troponin I.
Immunogen
Purified human cardiac troponin I.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
These antibodies are stable for at least one (1) year at -20°C to -70°C. Store product in appropriate aliquots to avoid multiple freeze-thaw cycles.
Storage buffer
PBS containing 0.1% NaN3
Purity
protein affinity purification
Clonality
monoclonal
Isotype
IgG2a
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG2a - Isotype Control
target relevance
Homo sapiens TNNI3
Troponin I, cardiac muscle
Protein names
Troponin I, cardiac muscle
Alternative names
Cardiac troponin I
Gene names
TNNI3
Protein family
Belongs to the troponin I family
Function
Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity
Structure
Binds to actin and tropomyosin. Interacts with TRIM63. Interacts with STK4/MST1
Post-translational modification
Phosphorylated at Ser-42 and Ser-44 by PRKCE; phosphorylation increases myocardium contractile dysfunction (By similarity). Phosphorylated at Ser-23 and Ser-24 by PRKD1; phosphorylation reduces myofilament calcium sensitivity. Phosphorylated preferentially at Thr-31. Phosphorylation by STK4/MST1 alters its binding affinity to TNNC1 (cardiac Tn-C) and TNNT2 (cardiac Tn-T)
Involvement in disease
Cardiomyopathy, familial hypertrophic, 7
A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.

Cardiomyopathy, familial restrictive 1
A heart disorder characterized by impaired filling of the ventricles with reduced diastolic volume, in the presence of normal or near normal wall thickness and systolic function.

Cardiomyopathy, dilated, 2A
A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.

Cardiomyopathy, dilated, 1FF
A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.

Keywords
3D-structure, Acetylation, Actin-binding, Cardiomyopathy, Direct protein sequencing, Disease variant, Muscle protein, Phosphoprotein, Proteomics identification, Reference proteome
Sequence
MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED TEKENREVGDWRKNIDALSGMEGRKKKFES
UniProt accession: P19429

Data

No results found

FAQ & Publications

Frequently Asked Questions
What is the recommended storage condition for the mouse anti-Cardiac Troponin I monoclonal antibody (8E10)?
The antibody should be stored at temperatures between -20°C and -70°C in appropriate aliquots to avoid multiple freeze-thaw cycles, ensuring stability for at least one year.
Which applications has the mouse anti-Cardiac Troponin I monoclonal antibody (8E10) been validated for?
This antibody has been tested and is suitable for use in Western blot (WB), enzyme-linked immunosorbent assay (ELISA), and immunocytochemistry/immunofluorescence (ICC/IF) applications.
What is the host species and isotype of the anti-Cardiac Troponin I monoclonal antibody (8E10)?
The antibody is a mouse monoclonal antibody of the IgG2a isotype.
What is the immunogen used to generate this monoclonal antibody targeting Cardiac Troponin I?
The immunogen used was purified human cardiac troponin I protein.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.