| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2a |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Cardiac Troponin I |
| available sizes | 100 µg |
mouse anti-Cardiac Troponin I monoclonal antibody (8E10) 5478
$235.00
Antibody summary
- Mouse monoclonal to Cardiac Troponin I
- Suitable for: WB,ELISA
- Isotype: IgG2a
- 100 µg
mouse anti-Cardiac Troponin I monoclonal antibody (8E10) 5478
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions These antibodies may be used in immunoassays and Western blots to detect and quantitate human cardiac troponin I. They may also be used to affinity purify cardiac troponin I. |
| Immunogen Purified human cardiac troponin I. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions These antibodies are stable for at least one (1) year at -20°C to -70°C. Store product in appropriate aliquots to avoid multiple freeze-thaw cycles. |
| Storage buffer PBS containing 0.1% NaN3 |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG2a |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2a - Isotype Control |
| target relevance |
|---|
| Homo sapiens TNNI3 Troponin I, cardiac muscle |
| Protein names Troponin I, cardiac muscle |
| Alternative names Cardiac troponin I |
| Gene names TNNI3 |
| Protein family Belongs to the troponin I family |
| Function Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity |
| Structure Binds to actin and tropomyosin. Interacts with TRIM63. Interacts with STK4/MST1 |
| Post-translational modification Phosphorylated at Ser-42 and Ser-44 by PRKCE; phosphorylation increases myocardium contractile dysfunction (By similarity). Phosphorylated at Ser-23 and Ser-24 by PRKD1; phosphorylation reduces myofilament calcium sensitivity. Phosphorylated preferentially at Thr-31. Phosphorylation by STK4/MST1 alters its binding affinity to TNNC1 (cardiac Tn-C) and TNNT2 (cardiac Tn-T) |
| Involvement in disease Cardiomyopathy, familial hypertrophic, 7 A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. Cardiomyopathy, familial restrictive 1 A heart disorder characterized by impaired filling of the ventricles with reduced diastolic volume, in the presence of normal or near normal wall thickness and systolic function. Cardiomyopathy, dilated, 2A A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Cardiomyopathy, dilated, 1FF A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. |
| Keywords 3D-structure, Acetylation, Actin-binding, Cardiomyopathy, Direct protein sequencing, Disease variant, Muscle protein, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED TEKENREVGDWRKNIDALSGMEGRKKKFES |
| UniProt accession: P19429 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended storage condition for the mouse anti-Cardiac Troponin I monoclonal antibody (8E10)?
The antibody should be stored at temperatures between -20°C and -70°C in appropriate aliquots to avoid multiple freeze-thaw cycles, ensuring stability for at least one year.
Which applications has the mouse anti-Cardiac Troponin I monoclonal antibody (8E10) been validated for?
This antibody has been tested and is suitable for use in Western blot (WB), enzyme-linked immunosorbent assay (ELISA), and immunocytochemistry/immunofluorescence (ICC/IF) applications.
What is the host species and isotype of the anti-Cardiac Troponin I monoclonal antibody (8E10)?
The antibody is a mouse monoclonal antibody of the IgG2a isotype.
What is the immunogen used to generate this monoclonal antibody targeting Cardiac Troponin I?
The immunogen used was purified human cardiac troponin I protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.