| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Calnexin |
| available sizes | 100 µg |
mouse anti-Calnexin monoclonal antibody (C2A1) 9154
$520.00
Antibody summary
- Mouse monoclonal to Calnexin
- Suitable for: WB,IHC
- Isotype: IgG1
- 100 µg
mouse anti-Calnexin monoclonal antibody (C2A1) 9154
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Immunoblotting: use at 1-10ug/ml. Immunohistochemistry: use at 1-10ug/ml. These are recommended concentrations. End user should determine optimal concentrations for their applications. |
| Immunogen Dictyostelium discoideum AX2 recombinant fragment. Accession no. P27824. |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product is stable for at least one (1) year at -20°C to -70°C. Reconstituted product should be stored in appropriate aliquots to avoid repeated freeze-thaw cycles. |
| Storage buffer Lyophilized, 0.1M Tris, 0.1M glycine, 2% sucrose |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens CANX Calnexin |
| Protein names Calnexin |
| Alternative names IP90, Major histocompatibility complex class I antigen-binding protein p88, p90 |
| Gene names CANX |
| Protein family Belongs to the calreticulin family |
| Function Calcium-binding protein that interacts with newly synthesized monoglucosylated glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins. Associated with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes, it may function as a signaling complex regulating thymocyte maturation. Additionally it may play a role in receptor-mediated endocytosis at the synapse |
| Subcellular location Endoplasmic reticulum membrane, Mitochondrion membrane, Melanosome membrane |
| Structure (Microbial infection) Interacts with HBV large envelope protein, isoform M; this association may be essential for isoform M proper secretion |
| Post-translational modification Phosphorylated at Ser-564 by MAPK3/ERK1. Phosphorylation by MAPK3/ERK1 increases its association with ribosomes (By similarity) Palmitoylation by DHHC6 leads to the preferential localization to the perinuclear rough ER. It mediates the association of calnexin with the ribosome-translocon complex (RTC) which is required for efficient folding of glycosylated proteins Ubiquitinated, leading to proteasomal degradation. Probably ubiquitinated by ZNRF4 |
| Keywords Acetylation, Alternative splicing, Calcium, Chaperone, Direct protein sequencing, Disulfide bond, Endoplasmic reticulum, Host-virus interaction, Lectin, Lipoprotein, Membrane, Metal-binding, Mitochondrion, Palmitate, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix, Ubl conjugation |
| Sequence MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGL VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRC ESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER PWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDE EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE |
| UniProt accession: P27824 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-Calnexin monoclonal antibody (C2A1) suitable for?
This antibody is validated for use in Western blotting (WB) and immunohistochemistry (IHC). Recommended dilutions for both applications are 1-10 µg/mL, though users should optimize concentrations for their specific experiments.
How should the mouse anti-Calnexin monoclonal antibody be stored to maintain stability?
The lyophilized antibody is stable for at least one year when stored at -20°C to -70°C. After reconstitution, it should be aliquoted and stored to prevent repeated freeze-thaw cycles, preserving antibody integrity.
What is the immunogen used to generate this mouse anti-Calnexin monoclonal antibody?
The antibody was raised against a recombinant fragment of Dictyostelium discoideum AX2 Calnexin, corresponding to UniProt accession number P27824.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.