| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | α-fetoprotein |
| available sizes | 200 µg |
mouse anti-α-Fetoprotein monoclonal antibody (AFP4A3) 6660
$231.00
Antibody summary
- Mouse monoclonal to α-Fetoprotein
- Suitable for: ELISA
- Isotype: IgG1
- 200 µg
mouse anti-α-Fetoprotein monoclonal antibody (AFP4A3) 6660
| target relevance |
|---|
| Homo sapiens AFP Alpha-fetoprotein |
| Protein names Alpha-fetoprotein |
| Alternative names Alpha-1-fetoprotein, Alpha-fetoglobulin |
| Gene names AFP |
| Protein family Belongs to the ALB/AFP/VDB family |
| Function Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties |
| Subcellular location Secreted |
| Structure Dimeric and trimeric forms have been found in addition to the monomeric form |
| Post-translational modification Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence Sulfated |
| Involvement in disease Alpha-fetoprotein deficiency A benign condition characterized by undetectable AFP levels in the amniotic fluid. Affected individuals are asymptomatic and present normal development. Alpha-fetoprotein, hereditary persistence A benign autosomal dominant condition characterized by continued expression of alpha-fetoprotein in adult life. |
| Keywords 3D-structure, Copper, Direct protein sequencing, Disulfide bond, Glycoprotein, Metal-binding, Nickel, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Secreted, Signal, Sulfation |
| Sequence MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATY KEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEG RHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILL WAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITV TKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKIT ECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSR RHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADII IGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQA QGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLI SKTRAALGV |
| UniProt accession: P02771 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the host species and isotype of the mouse anti-α-Fetoprotein monoclonal antibody (AFP4A3)?
The antibody is a mouse monoclonal antibody with an IgG1 isotype.
Which applications has the AFP4A3 antibody been tested and validated for?
This antibody has been tested for use in ELISA, immunocytochemistry/immunofluorescence (ICC/IF), and Western blotting (WB).
What are the recommended storage conditions for this α-Fetoprotein monoclonal antibody?
The antibody should be stored at 4°C in its supplied buffer, which is PBS at pH 7.4 containing 0.09% sodium azide (NaN3).
Is this antibody suitable for use in sandwich ELISA, and are there recommended capture and detection antibodies?
Yes, for sandwich ELISA, it is recommended to use antibody #34079 as the capture antibody and #34080 as the detection antibody. End users should optimize antibody concentrations for their specific samples.
What is the immunogen used to generate the mouse anti-α-Fetoprotein monoclonal antibody (AFP4A3)?
The immunogen is purified human alpha-fetoprotein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.