| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | ALG-2 Interacting Protein-X (ALIX) |
| available sizes | 100 µg |
mouse anti-ALG-2 Interacting Protein-X (ALIX0) monoclonal antibody (8E8) 9112
$520.00
Antibody summary
- Mouse monoclonal to ALG-2 Interacting Protein-X (ALIX)
- Suitable for: WB,IHC
- Isotype: IgG1
- 100 µg
mouse anti-ALG-2 Interacting Protein-X (ALIX0) monoclonal antibody (8E8) 9112
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Immunoblotting: use at 1-5ug/ml. A band of ~96kDa is detected. Immunohistochemistry: use at 5- 10ug/ml. These are recommended concentrations. End user should determine optimal concentrations for their applications. |
| Immunogen Recombinant human ALIX protein. |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product is stable for at least one (1) year at -20°C to -70°C. Reconstituted product should be stored in appropriate aliquots to avoid repeated freeze-thaw cycles. |
| Storage buffer Lyophilized, 0.1M Tris, 0.1M glycine, 2% sucrose |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens PDCD6IP Programmed cell death 6-interacting protein |
| Protein names Programmed cell death 6-interacting protein |
| Alternative names ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95 |
| Gene names PDCD6IP |
| Function Multifunctional protein involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complexes (PubMed:14739459). The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis (PubMed:17556548, PubMed:17853893). Adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis (PubMed:17556548, PubMed:17853893, PubMed:18641129). May play a role in the regulation of both apoptosis and cell proliferation. Regulates exosome biogenesis in concert with SDC1/4 and SDCBP (PubMed:22660413). By interacting with F-actin, PARD3 and TJP1 secures the proper assembly and positioning of actomyosin-tight junction complex at the apical sides of adjacent epithelial cells that defines a spatial membrane domain essential for the maintenance of epithelial cell polarity and barrier (By similarity) |
| Subcellular location Cytoplasm, cytosol, Melanosome, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Secreted, extracellular exosome, Cell junction, tight junction, Midbody, Midbody ring |
| Structure (Microbial infection) Interacts with ebola virus protein VP40 (via YPx(n)L/I motif) |
| Post-translational modification May be phosphorylated on tyrosine residues by activated PDGFRB |
| Involvement in disease Microcephaly 29, primary, autosomal recessive A form of microcephaly, a disease defined as a head circumference more than 3 standard deviations below the age, sex and ethnically matched mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. MCPH29 is characterized by small head circumference apparent at birth and associated with global developmental delay, impaired intellectual development, speech delay, and behavioral abnormalities. Affected individuals also have poor overall growth with short stature, mild dysmorphic facial features, and seizures. |
| Keywords 3D-structure, Acetylation, Alternative splicing, Apoptosis, Cell cycle, Cell division, Cell junction, Cytoplasm, Cytoskeleton, Direct protein sequencing, Host-virus interaction, Intellectual disability, Methylation, Phosphoprotein, Primary microcephaly, Protein transport, Proteomics identification, Reference proteome, Secreted, Tight junction, Transport |
| Sequence MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDK HEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEK SCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDIS PDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKE VFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDF SDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVP VSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTP SNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPA KTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALS VTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAY DNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAP SIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAG TAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS PGQAPYPGPQQPSYPFPQPPQQSYYPQQ |
| UniProt accession: Q8WUM4 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-ALG-2 Interacting Protein-X (ALIX) monoclonal antibody (8E8) been validated for?
This antibody has been tested and validated for use in Western blotting (WB) and immunohistochemistry (IHC) applications.
How should the mouse anti-ALG-2 Interacting Protein-X (ALIX) monoclonal antibody be stored to maintain stability?
The lyophilized antibody is stable for at least one year when stored at temperatures between -20°C and -70°C. After reconstitution, it should be aliquoted and stored appropriately to avoid repeated freeze-thaw cycles.
What is the recommended concentration for using this antibody in immunoblotting and immunohistochemistry?
For immunoblotting, a concentration of 1-5 µg/mL is recommended, where a band of approximately 96 kDa can be detected. For immunohistochemistry, the recommended concentration ranges from 5 to 10 µg/mL. Users should optimize concentrations for their specific applications.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.