Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the woocommerce-services domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /www/benchmarkantibodiescom_769/public/wp-includes/functions.php on line 6121

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the woocommerce-payments domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /www/benchmarkantibodiescom_769/public/wp-includes/functions.php on line 6121
Human CCL27 (CTACK) 7027 – benchmark antibodies Human CCL27 (CTACK) 7027
Skip to content

Human CCL27 (CTACK) 7027

$61.00$2,189.00

Summary

  • Expression: E.coli
  • Amino Acid Range: 25-112
SKU: 7027parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
accession

P10145

express system

E.coli

product tag

none

purity

> 97% by SDS PAGE

molecular weight

Predicted Molecular Mass: 8.386 kDa Extinction Coefficient: 7,450 M-1 cm-1 Actual Molecular Mass: 8.386 kDa by ESI Mass Spec

available size

100 µg, 1mg, 20 µg, 5 µg, 50 µg

endotoxin

<0.01 EU per 1μg of the protein by the LAL method

sequence

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP SLSQWFEHQERKLHGTLPKLNFGMLRKMG

Human CCL27 (CTACK) 7027
protein
Database link:
human Q9Y4X3
Size and concentration
5, 20, 50, 100, 1000µg and lyophilized
Form
Lyophilized
Storage Instructions
Avoid repeated freeze-thaw cycles:
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer
?Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water.
Shipping: Room Temp
Purity
> 97% by SDS PAGE and HPLC
target relevance
Cutaneous T-cell-attracting chemokine (CTACK/CCL27) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T cells during cutaneous inflammation. Interestingly, after CCR10-mediated internalization, CTACK, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior.
Protein names
C-C motif chemokine 27 (CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27)
Gene names
CCL27,CCL27 ILC SCYA27
Protein family
Intercrine beta (chemokine CC) family
Mass
12618Da
Function
Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10.
Subellular location
Secreted .
Tissues
Testis, thymus, placenta, ovary and skin.
Structure
Monomer, dimer, and tetramer. Heparin avidly promotes oligomerization. Interacts with TNFAIP6 (via Link domain).
Target Relevance information above includes information from UniProt accession: Q9Y4X3
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells
Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells

Publications

Publications

pmid title authors citation
We haven't added any publications to our database yet.
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Migration assay

Documents

#
Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information.