Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells.

Human CCL27 (CTACK) 7027

$61.00 – $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 25-112

SKU: 7027parent Categories: chemokine, proteins Tag: CCL27 (CTACK)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P10145
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 8.386 kDa Extinction Coefficient: 7,450 M-1 cm-1 Actual Molecular Mass: 8.386 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP SLSQWFEHQERKLHGTLPKLNFGMLRKMG

Human CCL27 (CTACK) 7027

protein
Database link: human Q9Y4X3
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer ?Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Cutaneous T-cell-attracting chemokine (CTACK/CCL27) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T cells during cutaneous inflammation. Interestingly, after CCR10-mediated internalization, CTACK, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior.
Protein names C-C motif chemokine 27 (CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27)
Gene names CCL27,CCL27 ILC SCYA27
Protein family Intercrine beta (chemokine CC) family
Mass 12618Da
Function Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10.
Subellular location Secreted .
Tissues Testis, thymus, placenta, ovary and skin.
Structure Monomer, dimer, and tetramer. Heparin avidly promotes oligomerization. Interacts with TNFAIP6 (via Link domain).
Target Relevance information above includes information from UniProt accession: Q9Y4X3
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.