Skip to content

rabbit anti-Glutamine synthetase monoclonal antibody (ZR431) 6426

Price range: $160.00 through $528.00

Antibody summary

  • Rabbit monoclonal to Glutamine synthetase
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG
  • Control: Normal liver
  • Visualization: Cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Glutamine synthetase monoclonal antibody ZR431 6426

antibody
Database link:
human P15104
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Normal liver
Immunogen
Recombinant fragment (around aa 50-250) of human GLUL protein
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens GLUL
Glutamine synthetase
Protein names
Glutamine synthetase
Alternative names
Glutamate--ammonia ligase, Palmitoyltransferase GLUL
Gene names
GLUL
Protein family
Belongs to the glutamine synthetase family
Function
Glutamine synthetase that catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine (PubMed:16267323, PubMed:30158707, PubMed:36289327). Its role depends on tissue localization: in the brain, it regulates the levels of toxic ammonia and converts neurotoxic glutamate to harmless glutamine, whereas in the liver, it is one of the enzymes responsible for the removal of ammonia (By similarity). Plays a key role in ammonium detoxification during erythropoiesis: the glutamine synthetase activity is required to remove ammonium generated by porphobilinogen deaminase (HMBS) during heme biosynthesis to prevent ammonium accumulation and oxidative stress (By similarity). Essential for proliferation of fetal skin fibroblasts (PubMed:18662667). Independently of its glutamine synthetase activity, required for endothelial cell migration during vascular development: acts by regulating membrane localization and activation of the GTPase RHOJ, possibly by promoting RHOJ palmitoylation (PubMed:30158707). May act as a palmitoyltransferase for RHOJ: able to autopalmitoylate and then transfer the palmitoyl group to RHOJ (PubMed:30158707). Plays a role in ribosomal 40S subunit biogenesis (PubMed:26711351). Through the interaction with BEST2, inhibits BEST2 channel activity by affecting the gating at the aperture in the absence of intracellular L-glutamate, but sensitizes BEST2 to intracellular L-glutamate, which promotes the opening of BEST2 and thus relieves its inhibitory effect on BEST2 (PubMed:36289327)
Catalytic activity
L-glutamate + NH4(+) + ATP = L-glutamine + ADP + phosphate + H(+)
L-cysteinyl-[protein] + hexadecanoyl-CoA = S-hexadecanoyl-L-cysteinyl-[protein] + CoA
Subcellular location
Cytoplasm, cytosol, Microsome, Mitochondrion, Cell membrane
Structure
Decamer; composed of two pentamers (PubMed:18005987). Interacts with PALMD (By similarity). Interacts with RHOJ (PubMed:30158707). Interacts with BEST2; this interaction tethers a fraction of GLUL to the membrane, causing a decrease of cytosolic glutamine synthase (GS) activity and inhibits the chloride channel activity of BEST2 by affecting the gating at the aperture in the absence of intracellular glutamate (PubMed:36289327)
Post-translational modification
Acetylated by EP300/p300; acetylation is stimulated by increased glutamine levels and promotes ubiquitin-mediated proteasomal degradation
Palmitoylated; undergoes autopalmitoylation
Ubiquitinated by ZNRF1 (By similarity). Ubiquitinated by the DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex called CRL4(CRBN), leading to proteasomal degradation (PubMed:26990986)
Involvement in disease
Glutamine deficiency, congenital
An autosomal recessive disorder characterized by variable brain malformations, encephalopathy, severe developmental delay, seizures, and decreased glutamine levels in bodily fluids. Death in early infancy may occur.

Developmental and epileptic encephalopathy 116
A form of epileptic encephalopathy, a heterogeneous group of early-onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. DEE116 is autosomal dominant form characterized by severe developmental delay, seizures, and white matter abnormalities.

Keywords
3D-structure, Acetylation, Angiogenesis, ATP-binding, Cell membrane, Cytoplasm, Disease variant, Endoplasmic reticulum, Epilepsy, Intellectual disability, Ligase, Lipoprotein, Magnesium, Manganese, Membrane, Metal-binding, Microsome, Mitochondrion, Nucleotide-binding, Palmitate, Phosphoprotein, Proteomics identification, Reference proteome, Transferase, Ubl conjugation
Sequence
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRI MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDP KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL LNETGDEPFQYKN
UniProt accession: P15104

Data

Formalin-fixed, paraffin-embedded human liver stained with anti-glutamine synthetase antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of hepatocytes around a central vein.
Formalin-fixed, paraffin-embedded human liver stained with anti-glutamine synthetase antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of hepatocytes around a central vein.

FAQ & Publications

Frequently Asked Questions
What species does the rabbit anti-Glutamine synthetase monoclonal antibody (ZR431) specifically react with?
This antibody specifically reacts with human Glutamine synthetase.
How should the rabbit anti-Glutamine synthetase monoclonal antibody be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.
What are the recommended dilutions for using the concentrated rabbit anti-Glutamine synthetase monoclonal antibody in immunohistochemistry?
The recommended dilution for the concentrated antibody in immunohistochemistry applications is between 1:100 and 1:200.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.