Immunohistochemistry (IHC) : Human colon carcinoma stained with anti-keratin 20 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of carcinoma glands.

rabbit anti-Cytokeratin 20 monoclonal antibody (ZR429) 6144

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Cytokeratin 20
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Colon carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6144parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 20, GI Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Cytokeratin 20 monoclonal antibody ZR429 6144

antibody
Database link: human P35900
Tested applications IHC
Recommended dilutions As directed
Application Notes Positive control: Colon carcinoma
Immunogen Recombinant human KRT20 protein fragment (around aa 196-323)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens KRT20 Keratin, type I cytoskeletal 20
Protein names Keratin, type I cytoskeletal 20
Alternative names Cytokeratin-20, Keratin-20, Protein IT
Gene names KRT20
Protein family Belongs to the intermediate filament family
Function Plays a significant role in maintaining keratin filament organization in intestinal epithelia. When phosphorylated, plays a role in the secretion of mucin in the small intestine (By similarity)
Subcellular location Cytoplasm
Structure Heterotetramer of two type I and two type II keratins. Associates with KRT8
Post-translational modification Hyperphosphorylation at Ser-13 occurs during the early stages of apoptosis but becomes less prominent during the later stages. Phosphorylation at Ser-13 also increases in response to stress brought on by cell injury (By similarity) Proteolytically cleaved by caspases during apoptosis. Cleavage occurs at Asp-228
Keywords Apoptosis, Coiled coil, Cytoplasm, Direct protein sequencing, Intermediate filament, Keratin, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLT GGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAY YRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVF DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMN EMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIEL QSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIK TRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV EENI
UniProt accession: P35900

Data

Human colon carcinoma stained with anti-keratin 20 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of carcinoma glands.

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-Cytokeratin 20 monoclonal antibody (ZR429) reactive with?

This antibody is reactive with human tissues, making it suitable for studies involving human samples.

How should the rabbit anti-Cytokeratin 20 monoclonal antibody (ZR429) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.