| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-CPA1 monoclonal antibody (ZR450) 6129
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to CPA1
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Pancreatic acinar cell carcinoma
- Visualization: Secreted and cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-CPA1 monoclonal antibody ZR450 6129
| target relevance |
|---|
| Homo sapiens CPA1 Carboxypeptidase A1 |
| Protein names Carboxypeptidase A1 |
| Gene names CPA1 |
| Protein family Belongs to the peptidase M14 family |
| Function Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro (PubMed:20385563, PubMed:8806703). Catalyzes the conversion of leukotriene C4 to leukotriene F4 via the hydrolysis of an amide bond (By similarity) |
| Catalytic activity Release of a C-terminal amino acid, but little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. leukotriene C4 + H2O = leukotriene F4 + glycine |
| Subcellular location Secreted |
| Structure Monomer. May form a complex with proelastase 2 |
| Keywords 3D-structure, Carboxypeptidase, Direct protein sequencing, Disulfide bond, Hydrolase, Metal-binding, Metalloprotease, Protease, Proteomics identification, Reference proteome, Secreted, Signal, Zinc, Zymogen |
| Sequence MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPG SPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYA TYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHS REWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTR SHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIK AFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQA SGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHPY |
| UniProt accession: P15085 |
Data
 |
| Formalin-fixed, paraffin-embedded human pancreatic acinar cell carcinoma stained with anti-CPA1 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-CPA1 monoclonal antibody (ZR450) validated for?
This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.
How should the rabbit anti-CPA1 monoclonal antibody be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C and avoid repeated freeze-thaw cycles.
Which species does the rabbit anti-CPA1 monoclonal antibody specifically react with?
The antibody specifically reacts with human CPA1 protein.
What are the recommended dilutions for using the concentrated form of this anti-CPA1 antibody in IHC?
For immunohistochemistry applications, the concentrated antibody is recommended to be diluted between 1:100 and 1:200.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.