Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human gastric adenocarcinoma stained with anti-claudin 18.2 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of tumor cells

rabbit anti-Claudin 18.2 monoclonal antibody (ZR451) 6125

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Claudin 18.2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Carcinomas
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6125parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Claudin 18.2, GI Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Claudin 18.2 monoclonal antibody ZR451 6125

antibody
Database link: human Q8IZS8
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Carcinomas
Immunogen Recombinant fragment (around aa1-100) of human Claudin18.2 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CACNA2D3 Voltage-dependent calcium channel subunit alpha-2/delta-3
Protein names Voltage-dependent calcium channel subunit alpha-2/delta-3
Alternative names Voltage-gated calcium channel subunit alpha-2/delta-3
Gene names CACNA2D3
Protein family Belongs to the calcium channel subunit alpha-2/delta family
Function The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G) (By similarity)
Subcellular location Membrane
Structure Dimer formed of alpha-2-2 and delta-2 chains; disulfide-linked. Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1 (CACNA1), alpha-2 (CACNA2D), beta (CACNB) and delta (CACNA2D) subunits in a 1:1:1:1 ratio (By similarity)
Post-translational modification N-glycosylated May be proteolytically processed into subunits alpha-2-3 and delta-3 that are disulfide-linked. It is however unclear whether such cleavage really takes place in vivo and has a functional role (By similarity)
Keywords Alternative splicing, Calcium, Calcium channel, Calcium transport, Disulfide bond, Glycoprotein, Ion channel, Ion transport, Membrane, Metal-binding, Phosphoprotein, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix, Transport, Voltage-gated channel
Sequence MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI CSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVA MPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELR LLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVM TNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDL HPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSD KGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGS FVYSIPFSTGPVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCAS LDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKRITL YDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQ KLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCE SVAPITMAPIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGAPSLQAQTVLL LLPLLLMLFSR
UniProt accession: Q8IZS8

Data

Formalin-fixed, paraffin-embedded human gastric adenocarcinoma stained with anti-claudin 18.2 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Claudin 18.2 monoclonal antibody (ZR451) specifically react with?

This antibody is reactive with human tissues only.

Which application is this antibody validated for, and what are the recommended dilutions?

The antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with recommended dilutions of 1:100 to 1:200 for the concentrated form.

What are the storage conditions for maintaining the stability of this antibody?

For short-term storage, keep the antibody at 2-8°C; for longer-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles.

What is the host species and clonality of the anti-Claudin 18.2 antibody, and what form is it supplied in?

The antibody is a rabbit monoclonal IgG supplied in both concentrated and prediluted liquid forms.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.