Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human colon carcinoma stained with anti-CEACAM5 polyclonal antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic and luminal surface staining of tumor cells

rabbit anti-CEACAM5 monoclonal antibody (ZR370) 6122

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CEACAM5
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Colon carcinoma
Visualization: Cytoplasmic and luminal membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6122parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CEACAM5, GI Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CEACAM5 monoclonal antibody ZR370 6122

antibody
Database link: human P06731
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Colon carcinoma
Immunogen Recombinant full-length human CEA protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CEACAM5 Cell adhesion molecule CEACAM5
Protein names Cell adhesion molecule CEACAM5
Alternative names Carcinoembryonic antigen, Carcinoembryonic antigen-related cell adhesion molecule 5, Meconium antigen 100
Gene names CEACAM5
Protein family Belongs to the immunoglobulin superfamily. CEA family
Function Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression (PubMed:10864933, PubMed:10910050, PubMed:2803308). Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6 (PubMed:2803308). Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells (PubMed:10910050)
Subcellular location Cell membrane, Apical cell membrane, Cell surface
Structure Homodimer
Post-translational modification Complex immunoreactive glycoprotein with a MW of 180 kDa comprising 60% carbohydrate
Keywords 3D-structure, Alternative splicing, Apoptosis, Cell adhesion, Cell membrane, Disulfide bond, Glycoprotein, GPI-anchor, Immunoglobulin domain, Lipoprotein, Membrane, Oncogene, Proteomics identification, Reference proteome, Repeat, Signal
Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQ HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFY TLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV NNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP TISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNN QSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTI SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN NSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQS LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP PDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNL ATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
UniProt accession: P06731

Data

Formalin-fixed, paraffin-embedded human colon carcinoma stained with anti-CEACAM5 polyclonal antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic and luminal surface staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution for the rabbit anti-CEACAM5 monoclonal antibody (ZR370) 6122?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated form is between 1:100 and 1:200.

How should the rabbit anti-CEACAM5 monoclonal antibody (ZR370) 6122 be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.