Immunohistochemistry (IHC) : Human colon adenocarcinoma stained with anti-CDX-2 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells .

rabbit anti-CDX2 monoclonal antibody (ZR215) 6119

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CDX2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Normal colon or colon adenocarcinoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6119parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CDX2, GI Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CDX2 monoclonal antibody ZR215 6119

antibody
Database link: human Q99626
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Normal colon or colon adenocarcinoma
Immunogen Recombinant human full-length CDX2 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CDX2 Homeobox protein CDX-2
Protein names Homeobox protein CDX-2
Alternative names CDX-3, Caudal-type homeobox protein 2
Gene names CDX2
Protein family Belongs to the Caudal homeobox family
Function Transcription factor which regulates the transcription of multiple genes expressed in the intestinal epithelium (By similarity). Binds to the promoter of the intestinal sucrase-isomaltase SI and activates SI transcription (By similarity). Binds to the DNA sequence 5'-ATAAAAACTTAT-3' in the promoter region of VDR and activates VDR transcription (By similarity). Binds to and activates transcription of LPH (By similarity). Activates transcription of CLDN2 and intestinal mucin MUC2 (By similarity). Binds to the 5'-AATTTTTTACAACACCT-3' DNA sequence in the promoter region of CA1 and activates CA1 transcription (By similarity). Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine. Binds preferentially to methylated DNA (PubMed:28473536)
Subcellular location Nucleus
Structure Can bind DNA as a monomer or homodimer
Post-translational modification Ubiquitinated, leading to its degradation by the proteasome Phosphorylation at Ser-60 reduces transactivation capacity. Phosphorylation at Ser-283 reduces transactivation capacity and also increases ubiquitin-dependent proteasome degradation
Keywords 3D-structure, Activator, Developmental protein, DNA-binding, Homeobox, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQS PGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPH HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ VKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVL GPTGGVLNPTVTQ
UniProt accession: Q99626

Data

Human colon adenocarcinoma stained with anti-CDX-2 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells .

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CDX2 monoclonal antibody (ZR215) specifically react with?

This antibody is reactive with human tissues, making it suitable for studies involving human samples.

How should the rabbit anti-CDX2 monoclonal antibody (ZR215) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

What are the recommended applications and dilution for using this anti-CDX2 antibody?

The antibody is suitable for immunohistochemistry on formalin-fixed, paraffin-embedded tissues. When used as a concentrate, a dilution of 1:100 to 1:200 is recommended.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.