Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human hepatic adenoma stained with anti-arginase-1 polyclonal antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic and nuclear staining of hepatocytes.

rabbit anti-Arginase-1 monoclonal antibody (ZR368) 6024

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Arginase-1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Liver
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6024parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Arginase-1, GI Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Arginase-1 monoclonal antibody ZR368 6024

antibody
Database link: human P05089
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Liver
Immunogen Recombinant human ARG1 protein fragment (aa300-400) (Exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens ARG1 Arginase-1
Protein names Arginase-1
Alternative names Liver-type arginase, Type I arginase
Gene names ARG1
Protein family Belongs to the arginase family
Function Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys
Catalytic activity L-arginine + H2O = urea + L-ornithine
Subcellular location Cytoplasm, Cytoplasmic granule
Structure Homotrimer (PubMed:16141327, PubMed:17469833, PubMed:17562323, PubMed:18802628, PubMed:2241902). Interacts with CMTM6 (PubMed:28813417)
Involvement in disease Argininemia A rare autosomal recessive disorder of the urea cycle. Arginine is elevated in the blood and cerebrospinal fluid, and periodic hyperammonemia occurs. Clinical manifestations include developmental delay, seizures, intellectual disability, hypotonia, ataxia and progressive spastic quadriplegia.
Keywords 3D-structure, Adaptive immunity, Alternative splicing, Arginine metabolism, Cytoplasm, Disease variant, Hydrolase, Immunity, Innate immunity, Manganese, Metal-binding, Phosphoprotein, Proteomics identification, Reference proteome, Urea cycle
Sequence MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT LACFGLAREGNHKPIDYLNPPK
UniProt accession: P05089

Data

Formalin-fixed, paraffin-embedded human hepatic adenoma stained with anti-arginase-1 polyclonal antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic and nuclear staining of hepatocytes.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Arginase-1 monoclonal antibody (ZR368) specifically react with?

This antibody is reactive with human species, making it suitable for studies involving human tissues.

For which applications is the rabbit anti-Arginase-1 monoclonal antibody (ZR368) validated?

The antibody is validated for use in Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody to maintain its stability?

For short-term storage, keep the antibody at 2-8°C; for long-term storage, it should be stored at -20°C, while avoiding repeated freeze/thaw cycles to preserve antibody integrity.

What is the immunogen used to generate the rabbit anti-Arginase-1 monoclonal antibody (ZR368)?

The immunogen is a recombinant human ARG1 protein fragment corresponding to amino acids 300-400, with the exact sequence proprietary.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.