| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-Prolactin monoclonal antibody (ZM203) 6346
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to Prolactin
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG1
- Control: Pituitary gland
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-Prolactin monoclonal antibody ZM203 6346
| target relevance |
|---|
| Homo sapiens PRL Prolactin |
| Protein names Prolactin |
| Gene names PRL |
| Protein family Belongs to the somatotropin/prolactin family |
| Function Prolactin acts primarily on the mammary gland by promoting lactation |
| Subcellular location Secreted |
| Structure Interacts with PRLR |
| Keywords 3D-structure, Direct protein sequencing, Disulfide bond, Glycoprotein, Hormone, Lactation, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
| UniProt accession: P01236 |
Data
![]() |
| Human pituitary gland stained with anti-Prolactin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of some glandular cells. |
FAQ & Publications
Frequently Asked Questions
What species does the mouse anti-Prolactin monoclonal antibody (ZM203) specifically recognize?
This antibody reacts with human Prolactin, making it suitable for studies involving human tissue samples.
Which applications is the mouse anti-Prolactin monoclonal antibody (ZM203) validated for?
It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.
How should the mouse anti-Prolactin monoclonal antibody be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles.
What immunogen was used to generate the mouse anti-Prolactin monoclonal antibody (ZM203)?
The antibody was produced using a recombinant fragment of human Prolactin protein corresponding to amino acids 63 to 201 as the immunogen.
Can you provide recommended dilutions for using the concentrated form of this antibody in IHC?
For immunohistochemistry applications, the concentrated antibody is recommended to be diluted between 1:100 and 1:200 for optimal staining.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.