Immunohistochemistry (IHC) : Human parathyroid gland stained with anti-PTH antibody using peroxidase conjugate and DAB chromogen. Note the cytoplasmic staining in glandular cells.

mouse anti-Parathyroid hormone (PTH) monoclonal antibody (ZM207) 6431

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Parathyroid hormone (PTH)
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Parathyroid
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6431parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Neuropathology/Endocrine, Parathyroid hormone (PTH)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Parathyroid hormone (PTH) monoclonal antibody ZM207 6431

antibody
Database link: human P01270
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Parathyroid
Immunogen Recombinant fragment corresponding to the C-terminus of human TP63 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens PTH Parathyroid hormone
Protein names Parathyroid hormone
Alternative names Parathormone, Parathyrin
Gene names PTH
Protein family Belongs to the parathyroid hormone family
Function Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion (PubMed:11604398, PubMed:35932760). Acts by binding to its receptor, PTH1R, activating G protein-coupled receptor signaling (PubMed:18375760, PubMed:35932760). Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (PubMed:21076856)
Subcellular location Secreted
Structure Interacts with PTH1R (via N-terminal extracellular domain)
Involvement in disease Hypoparathyroidism, familial isolated, 1 A form of hypoparathyroidism, a disorder characterized by hypocalcemia and hyperphosphatemia due to a deficiency of parathyroid hormone. Clinical features include seizures, tetany and cramps. FIH1 inheritance can be autosomal dominant or recessive.
Keywords 3D-structure, Cleavage on pair of basic residues, Direct protein sequencing, Disease variant, Hormone, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
UniProt accession: P01270

Data

Human parathyroid gland stained with anti-PTH antibody using peroxidase conjugate and DAB chromogen. Note the cytoplasmic staining in glandular cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution for using the mouse anti-Parathyroid hormone (PTH) monoclonal antibody (ZM207) in immunohistochemistry?

The recommended dilution for the concentrated form of this antibody in immunohistochemistry (IHC) is between 1:100 and 1:200.

How should the mouse anti-PTH monoclonal antibody (ZM207) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.