Immunohistochemistry (IHC) : Human malignant melanoma stained with anti-NGFR antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

mouse anti-NGFR monoclonal antibody (ZM55) 6288

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to NGFR
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Breast tissue
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6288parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Neuropathology/Endocrine, NGFR

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-NGFR monoclonal antibody ZM55 6288

antibody
Database link: human P08138
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Breast tissue
Immunogen Recombinant human p75 NGFR protein fragment (around aa 281-421)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens NGFR Tumor necrosis factor receptor superfamily member 16
Protein names Tumor necrosis factor receptor superfamily member 16
Alternative names Gp80-LNGFR, Low affinity neurotrophin receptor p75NTR, Low-affinity nerve growth factor receptor, Low-affinity nerve growth factor receptor p75NGFR, Low-affinity nerve growth factor receptor p75NGR, p75 ICD
Gene names NGFR
Function Low affinity receptor which can bind to NGF, BDNF, NTF3, and NTF4. Forms a heterodimeric receptor with SORCS2 that binds the precursor forms of NGF, BDNF and NTF3 with high affinity, and has much lower affinity for mature NGF and BDNF (PubMed:24908487). Plays an important role in differentiation and survival of specific neuronal populations during development (By similarity). Can mediate cell survival as well as cell death of neural cells. Plays a role in the inactivation of RHOA (PubMed:26646181). Plays a role in the regulation of the translocation of GLUT4 to the cell surface in adipocytes and skeletal muscle cells in response to insulin, probably by regulating RAB31 activity, and thereby contributes to the regulation of insulin-dependent glucose uptake (By similarity). Necessary for the circadian oscillation of the clock genes BMAL1, PER1, PER2 and NR1D1 in the suprachiasmatic nucleus (SCmgetaN) of the brain and in liver and of the genes involved in glucose and lipid metabolism in the liver (PubMed:23785138). Together with BFAR negatively regulates NF-kappa-B and JNK-related signaling pathways (PubMed:22566094)
Subcellular location Cell membrane, Cytoplasm, Perikaryon, Cell projection, growth cone, Cell projection, dendritic spine
Structure Homodimer; disulfide-linked (By similarity). Heterodimer with SORCS2. The extracellular domains of the heterodimer bind NGF (PubMed:22155786, PubMed:24908487). The cytoplasmic region of the heterodimer binds TRIO. NGF binding mediates dissociation of TRIO from the receptor complex (PubMed:22155786). Interacts with RTN4R (PubMed:19052207). Interacts with TRAF2, TRAF4, TRAF6, PTPN13 and RANBP9 (PubMed:10514511, PubMed:10544233, PubMed:12963025, PubMed:9915784). Interacts through TRAF6 with SQSTM1 which bridges NGFR to NTRK1 (PubMed:11244088). Interacts with BEX1 (By similarity). Interacts with BEX3 (By similarity). Interacts with KIDINS220 and NTRK1. Can form a ternary complex with NTRK1 and KIDINS220 and this complex is affected by the expression levels of KIDINS220. An increase in KIDINS220 expression leads to a decreased association of NGFR and NTRK1. Interacts with NTRK2; may regulate the ligand specificity of the NTRK2 receptor (By similarity). Interacts (via death domain) with RAB31 (By similarity). Interacts with LINGO1 (PubMed:14966521). Interacts with NRADD (By similarity). Interacts with MAGED1; the interaction antagonizes the association NGFR:NTRK1 (By similarity). Interacts (via death domain) with ARHGDIA and RIPK2 (PubMed:26646181). Interacts with BFAR (PubMed:22566094)
Post-translational modification N- and O-glycosylated O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc Phosphorylated on serine residues
Keywords 3D-structure, Alternative splicing, Apoptosis, Biological rhythms, Cell membrane, Cell projection, Cytoplasm, Developmental protein, Differentiation, Disulfide bond, Glycoprotein, Membrane, Neurogenesis, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Synapse, Transmembrane, Transmembrane helix
Sequence MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE STATSPV
UniProt accession: P08138

Data

Human malignant melanoma stained with anti-NGFR antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species reactivity does the mouse anti-NGFR monoclonal antibody (ZM55) 6288 exhibit?

This antibody reacts specifically with human NGFR.

Which applications is this mouse anti-NGFR monoclonal antibody validated for?

The antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for the mouse anti-NGFR monoclonal antibody (ZM55) 6288?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

What is the immunogen used to generate the mouse anti-NGFR monoclonal antibody (ZM55) 6288?

The immunogen is a recombinant human p75 NGFR protein fragment corresponding to amino acids approximately 281-421.

What is the host species and clonality of the anti-NGFR antibody ZM55 6288?

The antibody is a mouse monoclonal antibody of the IgG2b isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.