Immunohistochemistry (IHC) : Human cerebellum stained with anti-Neurofilament antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of neurons and neuronal processes.

mouse anti-Neurofilament monoclonal antibody (2F11) 6286

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Neurofilament
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Brain
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6286parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Neurofilament, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Neurofilament monoclonal antibody 2F11 6286

antibody
Database link: human P07196
Tested applications IHC
Recommended dilutions Concentrated 1:50-200
Application Notes Positive control: Brain
Immunogen Human NF-H isolated brain cells
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens NEFL Neurofilament light polypeptide
Protein names Neurofilament light polypeptide
Alternative names 68 kDa neurofilament protein, Neurofilament triplet L protein
Gene names NEFL
Protein family Belongs to the intermediate filament family
Function Neurofilaments usually contain three intermediate filament proteins: NEFL, NEFM, and NEFH which are involved in the maintenance of neuronal caliber. May additionally cooperate with the neuronal intermediate filament proteins PRPH and INA to form neuronal filamentous networks (By similarity)
Subcellular location Cell projection, axon, Cytoplasm, cytoskeleton
Structure Forms homodimers (in vitro) (By similarity). Forms heterodimers with NEFH or NEFM; which can further hetero-oligomerize (in vitro) (By similarity). Forms heterodimers with INA (in vitro) (By similarity). Interacts with ARHGEF28. Interacts with TRIM2
Post-translational modification O-glycosylated Phosphorylated in the head and rod regions by the PKC kinase PKN1, leading to the inhibition of polymerization Ubiquitinated in the presence of TRIM2 and UBE2D1
Involvement in disease Charcot-Marie-Tooth disease, demyelinating, type 1F A dominant demyelinating form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Demyelinating neuropathies are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. CMT1F is characterized by onset in infancy or childhood (range 1 to 13 years). Charcot-Marie-Tooth disease, axonal, type 2E A dominant axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal degeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Charcot-Marie-Tooth disease, dominant intermediate G An autosomal dominant, intermediate form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Dominant intermediate forms are characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec. CMTDIG is phenotypically variable. Most affected individuals have onset in the first or second decades of slowly progressive distal motor weakness and atrophy, resulting in gait instability and distal upper limb impairment, as well as distal sensory impairment.
Keywords Acetylation, Cell projection, Charcot-Marie-Tooth disease, Coiled coil, Cytoplasm, Cytoskeleton, Direct protein sequencing, Disease variant, Glycoprotein, Intermediate filament, Methylation, Neurodegeneration, Neuropathy, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQY AQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRT TKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEE KDKEEAEEEEAAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAK KKD
UniProt accession: P07196

Data

Human cerebellum stained with anti-Neurofilament antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of neurons and neuronal processes.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Neurofilament monoclonal antibody (2F11) react with?

This antibody is reactive with human species, specifically recognizing human neurofilament proteins.

What are the recommended storage conditions for the mouse anti-Neurofilament monoclonal antibody (2F11)?

For short term storage, keep the antibody at 2-8°C. For longer term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to maintain antibody integrity.

What applications is the mouse anti-Neurofilament monoclonal antibody (2F11) suitable for, and what controls are recommended?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. Brain tissue is recommended as a positive control for validation of staining.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.