Immunohistochemistry (IHC) : Human cerebellum stained with anti-NeuN antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of granular neuronal cells.

mouse anti-NeuN monoclonal antibody (A60) 6284

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to NeuN
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Brain tissue
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6284parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, NeuN, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-NeuN monoclonal antibody A60 6284

antibody
Database link: human A6NFN3
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Brain tissue
Immunogen Purified cell nuclei from mouse brain
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens RBFOX3 RNA binding protein fox-1 homolog 3
Protein names RNA binding protein fox-1 homolog 3
Alternative names Fox-1 homolog C, Neuronal nuclei antigen
Gene names RBFOX3
Function Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD)
Subcellular location Nucleus, Cytoplasm
Keywords Alternative splicing, Cytoplasm, Methylation, mRNA processing, mRNA splicing, Nucleus, Proteomics identification, Reference proteome, RNA-binding
Sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGS EASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFG QFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTN KKTGNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPTTGTAVAYRGAHLRGRGRAVYNTFRA APPPPPIPTYGAVVYQDGFYGAEIYGGYAAYRYAQPAAAAAAYSDSYGRVYAAADPYHHT IGPAATYSIGTM
UniProt accession: A6NFN3

Data

Human cerebellum stained with anti-NeuN antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of granular neuronal cells.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-NeuN monoclonal antibody (A60) suitable for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

How should the mouse anti-NeuN monoclonal antibody (A60) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.