Skip to content

mouse anti-Insulin monoclonal antibody (ZM83A & ZM83B) 6234

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to Insulin
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG1 + IgG1
  • Control: Normal pancreas
  • Visualization: Cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1 + IgG1

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Insulin monoclonal antibody ZM83A & ZM83B 6234

antibody
Database link:
human P01308
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Normal pancreas
Immunogen
Recombinant INS protein
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG1 + IgG1 - Isotype C
target relevance
Homo sapiens INS
Insulin
Protein names
Insulin
Gene names
INS
Protein family
Belongs to the insulin family
Function
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Subcellular location
Secreted
Structure
Heterodimer of a B chain and an A chain linked by two disulfide bonds (PubMed:25423173)
Involvement in disease
Hyperproinsulinemia
An autosomal dominant condition characterized by elevated levels of serum proinsulin-like material.

Type 1 diabetes mellitus 2
A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical features are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.

Diabetes mellitus, permanent neonatal, 4
A form of permanent neonatal diabetes mellitus, a type of diabetes characterized by onset of persistent hyperglycemia within the first six months of life. Initial clinical manifestations include intrauterine growth retardation, hyperglycemia, glycosuria, osmotic polyuria, severe dehydration, and failure to thrive. PNDM4 transmission pattern is consistent with autosomal dominant or autosomal recessive inheritance.

Maturity-onset diabetes of the young 10
A form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.

Keywords
3D-structure, Alternative splicing, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Direct protein sequencing, Disease variant, Disulfide bond, Glucose metabolism, Hormone, Pharmaceutical, Proteomics identification, Reference proteome, Secreted, Signal
Sequence
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
UniProt accession: P01308

Data

Human pancreas stained with anti-Insulin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of islet cells.
Human pancreas stained with anti-Insulin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of islet cells.

FAQ & Publications

Frequently Asked Questions
What species does the mouse anti-Insulin monoclonal antibody (ZM83A & ZM83B) 6234 specifically react with?
This antibody specifically reacts with human insulin, making it suitable for studies involving human tissues.
What are the recommended storage conditions for the mouse anti-Insulin monoclonal antibody (ZM83A & ZM83B) 6234?
For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.
Which applications is the mouse anti-Insulin monoclonal antibody (ZM83A & ZM83B) 6234 validated for, and what is the suggested dilution for immunohistochemistry?
This antibody is validated for immunohistochemistry on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated form is between 1:100 and 1:200.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.