| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-INSM1 monoclonal antibody (A8) 6233
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to INSM1
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG1
- Control: Neuroendocrine tumor
- Visualization: Nuclear
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-INSM1 monoclonal antibody A8 6233
| target relevance |
|---|
| Danio rerio INSM1A Insulinoma-associated protein 1a |
| Protein names Insulinoma-associated protein 1a |
| Alternative names Insulinoma-associated 1-like protein a, Zinc finger protein IA-1a |
| Gene names insm1a |
| Protein family Belongs to the INSM1 family |
| Function May act as a transcriptional regulator. May play a role in neurogenesis and neuroendocrine cell differentiation during embryonic development (By similarity) |
| Subcellular location Nucleus |
| Keywords Developmental protein, Differentiation, DNA-binding, Metal-binding, Neurogenesis, Nucleus, Reference proteome, Repeat, Transcription, Transcription regulation, Zinc, Zinc-finger |
| Sequence MPRGFLVKRNKKATPVSYRVRSEEDEQGAFVAQDVPCARRPVSPVQFGNPETVYRAMYSP TRPVSREHERACLERRFNLGSPISAESFPAAPNCSDQAPVDLKIGTSNSNRTGTTVTTKR PASDTERKGKPASKKAKAMRKLQFEDEMTTSPVLGLKIKEGPVEQKPRSQCASGDKPLGE FVCQLCREAYADPFSLAQHKCSRIVRIEYRCPECDKLFSCPANLASHRRWHKPKQSAESN KTPAPEKEETSSDRDTPSPGLSESGSEDGLYDCQHCGKKFKRQAYLKKHVTAHHDAPEKP QSHAPLNLSASECHLCPVCGENFPSRMSQERHIRLQHSAQVYPCKYCPAMFYSSPGLTRH INKCHPSENRQVILLQMPVRPAC |
| UniProt accession: Q6P0F9 |
Data
![]() |
| Human pancreas stained with anti-INSM1 antibody using peroxidase-conjugate and DAB chromogen Note the nuclear staining of islet cells. |
FAQ & Publications
Frequently Asked Questions
What species does the mouse anti-INSM1 monoclonal antibody (A8) specifically react with?
This antibody specifically reacts with human INSM1 protein.
For which application is the mouse anti-INSM1 monoclonal antibody (A8) validated and recommended?
It is validated and recommended for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.
What are the recommended storage conditions for maintaining the stability of this antibody?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C while avoiding freeze-thaw cycles.
What is the immunogen used to generate the mouse anti-INSM1 monoclonal antibody (A8)?
The immunogen corresponds to amino acids 81-125 at the N-terminus of the human INSM1 protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.