Skip to content

mouse anti-Growth Hormone monoclonal antibody (ZM140) 6205

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to Growth Hormone
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG2b
  • Control: Pituitary
  • Visualization: Cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG2b

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Growth Hormone monoclonal antibody ZM140 6205

antibody
Database link:
human P01241
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Pituitary
Immunogen
A recombinant human Growth Hormone (GH) fragment (aa 58-187)
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG2b
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG2b - Isotype Control
target relevance
Homo sapiens GH1
Somatotropin
Protein names
Somatotropin
Alternative names
Growth hormone, Growth hormone 1, Pituitary growth hormone
Gene names
GH1
Protein family
Belongs to the somatotropin/prolactin family
Function
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Subcellular location
Secreted
Structure
Monomer, dimer, trimer, tetramer and pentamer, disulfide-linked or non-covalently associated, in homomeric and heteromeric combinations. Can also form a complex either with GHBP or with the alpha2-macroglobulin complex
Involvement in disease
Growth hormone deficiency, isolated, 1A
An autosomal recessive, severe deficiency of growth hormone leading to dwarfism. Patients often develop antibodies to administered growth hormone.

Growth hormone deficiency, isolated, 1B
An autosomal recessive deficiency of growth hormone leading to short stature. Patients have low but detectable levels of growth hormone, significantly retarded bone age, and a positive response and immunologic tolerance to growth hormone therapy.

Kowarski syndrome
A syndrome clinically characterized by short stature associated with bioinactive growth hormone, normal or slightly increased growth hormone secretion, pathologically low insulin-like growth factor 1 levels, and normal catch-up growth on growth hormone replacement therapy.

Growth hormone deficiency, isolated, 2
An autosomal dominant deficiency of growth hormone leading to short stature. Clinical severity is variable. Patients have a positive response and immunologic tolerance to growth hormone therapy.

Keywords
3D-structure, Alternative splicing, Direct protein sequencing, Disease variant, Disulfide bond, Dwarfism, Hormone, Metal-binding, Pharmaceutical, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal, Zinc
Sequence
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
UniProt accession: P01241

Data

Human pituitary stained with anti-GH antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of glandular cells.
Human pituitary stained with anti-GH antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of glandular cells.

FAQ & Publications

Frequently Asked Questions
What sample types are compatible with the Campylobacter jejuni IgA ELISA Kit MD-6205?
The kit is suitable for use with serum, plasma, and whole blood samples for detection of Campylobacter jejuni reactive IgA.
How should the Campylobacter jejuni IgA ELISA Kit MD-6205 be stored to maintain its stability?
The kit components should be stored at 2-8°C to ensure proper stability and performance.
What is the assay format and detection method used in the Campylobacter jejuni IgA ELISA Kit MD-6205?
This kit utilizes an indirect and quantitative ELISA format to detect IgA antibodies reactive to Campylobacter jejuni.
What species does the mouse anti-Growth Hormone monoclonal antibody (ZM140) react with?
This antibody specifically reacts with human Growth Hormone.
Which applications is the mouse anti-Growth Hormone monoclonal antibody (ZM140) validated for?
It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.
How should the mouse anti-Growth Hormone monoclonal antibody (ZM140) be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze at -20°C while avoiding freeze-thaw cycles.
What is the recommended dilution for using the concentrated mouse anti-Growth Hormone monoclonal antibody (ZM140) in IHC?
The recommended dilution range for the concentrated antibody in IHC is between 1:100 and 1:200.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.