Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human gastric antral mucosa stained with anti-gastrin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of few G-cells

mouse anti-Gastrin monoclonal antibody (ZM359) 6189

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Gastrin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Normal gastric mucosa
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6189parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Gastrin, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Gastrin monoclonal antibody ZM359 6189

antibody
Database link: human P01350
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Normal gastric mucosa
Immunogen Recombinant full-length human GAST protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens GAST Gastrin
Protein names Gastrin
Gene names GAST
Protein family Belongs to the gastrin/cholecystokinin family
Function Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Subcellular location Secreted
Post-translational modification Two different processing pathways probably exist in antral G-cells. In the dominant pathway progastrin is cleaved at three sites resulting in two major bioactive gastrins, gastrin-34 and gastrin-17. In the putative alternative pathway, progastrin may be processed only at the most C-terminal dibasic site resulting in the synthesis of gastrin-71 Sulfation enhances proteolytic processing, and blocks peptide degradation. Levels of sulfation differ between proteolytically-cleaved gastrins. Thus, gastrin-6 is almost 73% sulfated, whereas the larger gastrins are less than 50% sulfated. Sulfation levels are also tissue-specific
Keywords 3D-structure, Amidation, Cleavage on pair of basic residues, Direct protein sequencing, Hormone, Phosphoprotein, Proteomics identification, Pyrrolidone carboxylic acid, Reference proteome, Secreted, Signal, Sulfation
Sequence MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
UniProt accession: P01350

Data

Formalin-fixed, paraffin-embedded human gastric antral mucosa stained with anti-gastrin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of few G-cells

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Gastrin monoclonal antibody (ZM359) specifically react with?

This antibody is reactive with human Gastrin protein.

Which applications and sample types is this mouse anti-Gastrin antibody validated for?

It is suitable for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for preserving the integrity of this antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, store at -20°C and avoid repeated freeze/thaw cycles.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.