Immunohistochemistry (IHC) : Human colon carcinoma stained with anti-keratin 20 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of carcinoma glands.

mouse anti-Cytokeratin 20 monoclonal antibody (Ks20.8) 6143

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cytokeratin 20
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Colon carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6143parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 20, GI Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cytokeratin 20 monoclonal antibody Ks20.8 6143

antibody
Database link: human P35900
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Colon carcinoma
Immunogen Semi-purified human cytokeratin preparation
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens KRT20 Keratin, type I cytoskeletal 20
Protein names Keratin, type I cytoskeletal 20
Alternative names Cytokeratin-20, Keratin-20, Protein IT
Gene names KRT20
Protein family Belongs to the intermediate filament family
Function Plays a significant role in maintaining keratin filament organization in intestinal epithelia. When phosphorylated, plays a role in the secretion of mucin in the small intestine (By similarity)
Subcellular location Cytoplasm
Structure Heterotetramer of two type I and two type II keratins. Associates with KRT8
Post-translational modification Hyperphosphorylation at Ser-13 occurs during the early stages of apoptosis but becomes less prominent during the later stages. Phosphorylation at Ser-13 also increases in response to stress brought on by cell injury (By similarity) Proteolytically cleaved by caspases during apoptosis. Cleavage occurs at Asp-228
Keywords Apoptosis, Coiled coil, Cytoplasm, Direct protein sequencing, Intermediate filament, Keratin, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLT GGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAY YRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVF DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMN EMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIEL QSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIK TRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV EENI
UniProt accession: P35900

Data

Human colon carcinoma stained with anti-keratin 20 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of carcinoma glands.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-Cytokeratin 20 monoclonal antibody (Ks20.8) validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

Which species does the mouse anti-Cytokeratin 20 monoclonal antibody (Ks20.8) react with?

The antibody specifically reacts with human Cytokeratin 20.

How should the mouse anti-Cytokeratin 20 monoclonal antibody (Ks20.8) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C; for long-term storage, it should be kept at -20°C while avoiding freeze/thaw cycles.

What is the recommended dilution for using the concentrated form of this Cytokeratin 20 antibody in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200 for immunohistochemistry applications.

What type of antibody is the mouse anti-Cytokeratin 20 (Ks20.8) in terms of clonality and isotype?

The antibody is a mouse monoclonal antibody of the IgG2a isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.