Immunohistochemistry (IHC) : Human pancreatic ducts stained with anti-keratin 19 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of ductal cells.

mouse anti-Cytokeratin 19 monoclonal antibody (BA17) 6140

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cytokeratin 19
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Skin
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6140parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 19, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cytokeratin 19 monoclonal antibody BA17 6140

antibody
Database link: human P08727
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Skin
Immunogen Detergent-insoluble extract of human mammary epithelial organoids
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens KRT19 Keratin, type I cytoskeletal 19
Protein names Keratin, type I cytoskeletal 19
Alternative names Cytokeratin-19, Keratin-19
Gene names KRT19
Protein family Belongs to the intermediate filament family
Function Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle
Structure (Microbial infection) Interacts with hepatitis C virus/HCV core protein
Keywords 3D-structure, Coiled coil, Direct protein sequencing, Host-virus interaction, Intermediate filament, Keratin, Methylation, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
UniProt accession: P08727

Data

Human pancreatic ducts stained with anti-keratin 19 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of ductal cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Cytokeratin 19 monoclonal antibody (BA17) specifically react with?

This monoclonal antibody is reactive with human tissues.

What are the recommended storage conditions for maintaining the stability of this Cytokeratin 19 antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.