Immunohistochemistry (IHC) : Human tonsil stained with anti-CD57 antibody using peroxidase-conjugate and DAB chromogen. Note intense cell membrane staining of natural killer cells.

mouse anti-CD57 monoclonal antibody (NK-1) 6104

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD57
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgM
Control: Lymph node or tonsil
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6104parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD57, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgM
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD57 monoclonal antibody NK-1 6104

antibody

Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lymph node or tonsil
Immunogen Human peripheral blood mononuclear cells
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgM
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgM - Isotype Control

target relevance
Homo sapiens KLRC2 NKG2-C type II integral membrane protein
Protein names NKG2-C type II integral membrane protein
Alternative names CD159 antigen-like family member C, NK cell receptor C, NKG2-C-activating NK receptor
Gene names KLRC2
Function Immune activating receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules, likely playing a role in the generation and effector functions of adaptive natural killer (NK) cells and in maternal-fetal tolerance during pregnancy (PubMed:30134159, PubMed:37264229, PubMed:9754572). Regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, and in particular may play a role in adaptive NK cell response to viral infection (PubMed:20952657, PubMed:21825173). Upon HLA-E-peptide binding, transmits intracellular signals via the adapter protein TYROBP/DAP12, triggering the phosphorylation of proximal signaling molecules and cell activation (PubMed:15940674, PubMed:9655483)
Subcellular location Cell membrane
Structure Heterodimer with KLRD1; disulfide-linked. KLRD1-KLRC2 receptor complex interacts with TYROBP homodimer; this interaction is necessary for the expression on the cell surface (PubMed:20890284, PubMed:9655483). KLRD1-KLRC2 receptor complex can bind with low affinity to HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia (PubMed:18083576, PubMed:9486650)
Keywords 3D-structure, Adaptive immunity, Cell membrane, Disulfide bond, Glycoprotein, Immunity, Innate immunity, Lectin, Membrane, Proteomics identification, Receptor, Reference proteome, Signal-anchor, Transmembrane, Transmembrane helix
Sequence MNKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYD CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNFSPNTRTQKARHCGHCPEE WITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSS HHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
UniProt accession: P26717

Data

Human tonsil stained with anti-CD57 antibody using peroxidase-conjugate and DAB chromogen. Note intense cell membrane staining of natural killer cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD57 monoclonal antibody (NK-1) 6104 react with?

This antibody specifically reacts with human tissues.

Which applications is the mouse anti-CD57 monoclonal antibody (NK-1) 6104 validated for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C while avoiding freeze/thaw cycles to maintain stability.

What is the host species and clonality of the anti-CD57 antibody (NK-1) 6104?

The antibody is a mouse monoclonal antibody of the IgM isotype.

What is the immunogen used to generate the mouse anti-CD57 monoclonal antibody (NK-1) 6104?

The immunogen consists of human peripheral blood mononuclear cells.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.