Immunohistochemistry (IHC) : Human thyroid medullary carcinoma stained with anti-Calcitonin antibody using peroxidase-conjugate and DAB. Note cytoplasmic staining of tumor cells.

mouse anti-Calcitonin monoclonal antibody (ZM301) 6046

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Calcitonin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Thyroid or medullary carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6046parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Calcitonin, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Calcitonin monoclonal antibody ZM301 6046

antibody
Database link: human P01258
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Thyroid or medullary carcinoma
Immunogen Recombinant fragment of human Calcitonin protein (around aa 3-116)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens CALCA Calcitonin
Protein names Calcitonin
Gene names CALCA
Protein family Belongs to the calcitonin family
Function Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. Calcitonin function is mediated by the calcitonin receptor/CALCR and the CALCR-RAMP2 (AMYR2) receptor complex (PubMed:35324283)
Subcellular location Secreted
Keywords 3D-structure, Alternative splicing, Amidation, Cleavage on pair of basic residues, Direct protein sequencing, Disulfide bond, Hormone, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR DMSSDLERDHRPHVSMPQNAN
UniProt accession: P01258

Data

Human thyroid medullary carcinoma stained with anti-Calcitonin antibody using peroxidase-conjugate and DAB. Note cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Calcitonin monoclonal antibody (ZM301) specifically react with?

This monoclonal antibody is reactive with human Calcitonin.

Which applications is this anti-Calcitonin antibody validated for?

It is validated for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-Calcitonin antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze at -20°C while avoiding repeated freeze/thaw cycles.

What is the recommended dilution range for using the concentrated form of this antibody in IHC?

The concentrated antibody should be diluted between 1:100 and 1:200 for optimal immunohistochemistry results.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.