Human pituitary stained with anti-ACTH monoclonal antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic/nuclear staining of ACTH secreting cells.

mouse anti-ACTH monoclonal antibody (ZM98) 6010

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to ACTH (Corticotropin)
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Pituitary
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6010parent Categories: antibody, Zeta IHC antibodies Tags: ACTH, anatomy, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-ACTH moclonal antibody ZM98 6010

antibody
Database link: human P01189
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Pituitary
Immunogen Synthetic peptide corresponding to aa 25-39 of human ACTH (NGAEDESAEAFPLEF)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens POMC Pro-opiomelanocortin
Protein names Pro-opiomelanocortin
Alternative names Corticotropin-lipotropin
Gene names POMC
Protein family Belongs to the POMC family
Function Precursor protein of pituitary hormones that are involved in diverse physiological processes, including the regulation of energy balance, stress response, immune function and skin pigmentation
Subcellular location Secreted
Post-translational modification Specific enzymatic cleavages at paired basic residues yield the different active peptides O-glycosylated; reducing sugar is probably N-acetylgalactosamine
Involvement in disease Obesity A condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Obesity, early-onset, with adrenal insufficiency and red hair An autosomal recessive disorder characterized by early-onset obesity due to severe hyperphagia, pigmentary abnormalities, mainly pale skin and red hair, and secondary hypocortisolism.
Keywords 3D-structure, Acetylation, Amidation, Cleavage on pair of basic residues, Direct protein sequencing, Disulfide bond, Endorphin, Glycoprotein, Hormone, Obesity, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF MTSEKSQTPLVTLFKNAIIKNAYKKGE
UniProt accession: P01189

Data

Human pituitary stained with anti-ACTH monoclonal antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic/nuclear staining of ACTH secreting cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-ACTH monoclonal antibody (ZM98) 6010 specifically react with?

This antibody specifically reacts with human samples, making it suitable for detecting ACTH in human tissues.

What are the recommended storage conditions for maintaining the stability of the mouse anti-ACTH monoclonal antibody (ZM98) 6010?

For short-term storage, keep the antibody at 2-8°C, and for longer-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.