Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
accession | P10145 |
express system | E.coli |
product tag | none |
purity | > 97% by SDS PAGE |
molecular weight | Predicted Molecular Mass: 8.386 kDa Extinction Coefficient: 7,450 M-1 cm-1 Actual Molecular Mass: 8.386 kDa by ESI Mass Spec |
available size | 100 µg, 1mg, 20 µg, 5 µg, 50 µg |
endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQ RVVEKFLKRAEN |
Interleukin 8 (IL-8 /CXCL8) 8013
protein |
---|
Database link: human P10145 |
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
Form Lyophilized |
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
Purity > 97% by SDS PAGE and HPLC |
target relevance |
---|
Interleukin 8 (IL-8 /CXCL8) is secreted primarily by macrophages and monocytes. It is one of the key mediators for inflammatory responses. IL-8 is a strong chemotractant for neutrophils and monocytes promoting activation of these cells by binding to two cell surface receptors, CXCR1 and CXCR2. It is also a strong angiogenic agent and is considered to play a role in the pathogenesis of bronchiolitis. |
Protein names Interleukin-8 (IL-8) (C-X-C motif chemokine 8) (Chemokine (C-X-C motif) ligand 8) (Emoctakin) (Granulocyte chemotactic protein 1) (GCP-1) (Monocyte-derived neutrophil chemotactic factor) (MDNCF) (Monocyte-derived neutrophil-activating peptide) (MONAP) (Neutrophil-activating protein 1) (NAP-1) (Protein 3-10C) (T-cell chemotactic factor) [C |
Gene names CXCL8,CXCL8 IL8 |
Protein family Intercrine alpha (chemokine CxC) family |
Mass 11098Da |
Function Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection (PubMed:18692776, PubMed:7636208). Also plays an important role in neutrophil activation (PubMed:2145175, PubMed:9623510). Released in response to an inflammatory stimulus, exerts its effect by binding to the G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes and endothelial cells (PubMed:1840701, PubMed:1891716). G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptor and activation by IL8 leads to beta and gamma subunits release from Galpha (GNAI2 in neutrophils) and activation of several downstream signaling pathways including PI3K and MAPK pathways (PubMed:11971003, PubMed:8662698). |
Subellular location Secreted. |
Structure Homodimer (PubMed:31235521). Dimer formation is disrupted by tick evasin-3 (PubMed:31235521). Interacts with TNFAIP6 (via Link domain); this interaction interferes with chemokine binding to glycosaminoglycans. |
Post-translational modification Several N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form.; Citrullination at Arg-27 prevents proteolysis, and dampens tissue inflammation, it also enhances leukocytosis, possibly through impaired chemokine clearance from the blood circulation.; (Microbial infection) Cleaved by group A Streptococcus protease SpyCEP; leading to impaired neutrophil endothelial transmigration and thus increased virulence. |
Target Relevance information above includes information from UniProt accession: P10145 |
The UniProt Consortium |
Data
Migration Assay: Cells expressing recombinant CXCR1 were assayed for migration through a transwell filter at various concentrations of WT IL-8. Responses are expressed as the % of total input cells. |
Publications
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.pmid | title | authors | citation |
---|
Protocols
relevant to this product |
---|
Migration assay |
Documents
# | ||
---|---|---|
Please enter your product and batch number here to retrieve - product datasheet, SDS, and QC information. |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.