| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| target | Humanized CD28 mAb |
| species reactivity | Human |
| applications | Indirect ELISA Sandwich |
| assay type | Indirect & quantitative |
| available size | 96 tests |
| sensitivity | 0.281ng/ml |
| range | 0.469-30ng/ml |
Humanized CD28 monoclonal antibody ELISA Kit 60005
$570.00
Summary
- ELISA kit for research use (RUO)
- Reactivity: Humanized CD28 mAb
- Suitable for: ELISA
- Time:3 hours
- Sample types:Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples
Humanized CD28 monoclonal antibody ELISA Kit
| kit | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Assay type ELISA | ||||||||||||||||||
| Research area biologic | ||||||||||||||||||
| Sample type Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples | ||||||||||||||||||
Components
| ||||||||||||||||||
| Storage Store at 2-8°C. |
| target relevance |
|---|
| Homo sapiens CD28 T-cell-specific surface glycoprotein CD28 |
| Protein names T-cell-specific surface glycoprotein CD28 |
| Alternative names TP44 |
| Gene names CD28 |
| Function Receptor that plays a role in T-cell activation, proliferation, survival and the maintenance of immune homeostasis (PubMed:1650475, PubMed:7568038). Functions not only as an amplifier of TCR signals but delivers unique signals that control intracellular biochemical events that alter the gene expression program of T-cells (PubMed:24665965). Stimulation upon engagement of its cognate ligands CD80 or CD86 increases proliferation and expression of various cytokines in particular IL2 production in both CD4(+) and CD8(+) T-cell subsets (PubMed:12196291, PubMed:1650475, PubMed:35397202). Mechanistically, ligation induces recruitment of protein kinase C-theta/PRKCQ and GRB2 leading to NF-kappa-B activation via both PI3K/Akt-dependent and -independent pathways (PubMed:21964608, PubMed:24665965, PubMed:7568038). In conjunction with TCR/CD3 ligation and CD40L costimulation, enhances the production of IL4 and IL10 in T-cells (PubMed:8617933) |
| Subcellular location Cell surface |
| Structure Interacts with CD40LG |
| Post-translational modification Phosphorylated by LCK (PubMed:7568038). Dephosphorylated by PTPN11 (PubMed:36114179) Tyrosine phosphorylated induced by CD40LG |
| Involvement in disease Immunodeficiency 123 with HPV-related verrucosis An autosomal recessive immunologic disorder characterized by susceptibility to human papilloma virus (HPV) infections and the development of HPV-related common verrucosis in the first decade of life. In some patients with HPV2 infection, warts may progress to severe generalized hyperkeratotic cutaneous papillomatosis with cutaneous horns ('tree-man' phenotype). In patients with HPV4 infection, warts remains stable and may even regress with age. |
| Keywords 3D-structure, Alternative splicing, Cell membrane, Disease variant, Disulfide bond, Glycoprotein, Immunoglobulin domain, Membrane, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Signal, Transmembrane, Transmembrane helix |
| Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS |
| UniProt accession: P10747 |
Data
Standard Curve
X axis: log |
Y axis: linear
| Standard | STD [ng/mL] | OD1 | OD2 | Average OD | Corrected OD |
|---|---|---|---|---|---|
| Blank #8 | 0 | 0.04 | 0.04 | 0.04 | 0 |
| Standard #7 | 0.47 | 0.19 | 0.19 | 0.19 | 0.15 |
| Standard #6 | 0.94 | 0.33 | 0.34 | 0.33 | 0.29 |
| Standard #5 | 1.88 | 0.43 | 0.45 | 0.44 | 0.4 |
| Standard #4 | 3.75 | 0.64 | 0.66 | 0.65 | 0.61 |
| Standard #3 | 7.5 | 1.01 | 1.04 | 1.02 | 0.98 |
| Standard #2 | 15 | 1.56 | 1.61 | 1.59 | 1.54 |
| Standard #1 | 30 | 2.08 | 2.14 | 2.11 | 2.07 |
Precision
| Sample | n | Mean | Standard Deviation | CV (%) |
|---|---|---|---|---|
| Intra Sample 1 | 20 | 0.94 | 0.05 | 5.21 |
| Intra Sample 2 | 20 | 3.72 | 0.18 | 4.89 |
| Intra Sample 3 | 20 | 15.11 | 0.75 | 4.99 |
| Inter Sample 1 | 20 | 1 | 0.05 | 5.41 |
| Inter Sample 2 | 20 | 3.87 | 0.2 | 5.18 |
| Inter Sample 3 | 20 | 14.8 | 0.7 | 4.76 |
Recovery
| Matrix | Recovery Range (%) | Average (%) |
|---|---|---|
| Serum(n=5) | 85-99 | 92 |
| EDTA Plasma(n=5) | 87-104 | 97 |
| HeparinPlasma(n=5) | 88-104 | 98 |
Stability
| 37°C 1 Month (%) | 2–8°C 6 Months (%) | 2–8°C 12 Months (%) |
|---|---|---|
| 80 | 95-100 | 85-98 |
Linearity
| Sample | 1:2 Dilution (%) | 1:4 Dilution (%) | 1:8 Dilution (%) |
|---|---|---|---|
| Serum(n=5) | 90-105% | 85-98% | 86-96% |
| EDTAPlasma(n=5) | 85-95% | 88-101% | 92-100% |
| Heparin Plasma(n=5) | 90-103% | 85-101% | 85-100% |
FAQ & Publications
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| Relevant to this product |
|---|
| View Protocol | View PDF |
Documents
| # | ||
|---|---|---|
| Please enter your product and batch number here. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.