Skip to content

rabbit anti-HSP70 monoclonal antibody (ZR152) 6217

Price range: $160.00 through $528.00

Antibody summary

  • Rabbit monoclonal to HSP70
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:Rabbit IgG
  • Control: Hepatocellular carcinoma
  • Visualization: Nuclear and cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6217parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

Rabbit IgG

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-HSP70 monoclonal antibody ZR152 6217

antibody
Database link:
human P11142
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Hepatocellular carcinoma
Immunogen
Recombinant fragment (around aa400-600) of human HSPA1B protein
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens HSPA8
Heat shock cognate 71 kDa protein
Protein names
Heat shock cognate 71 kDa protein
Alternative names
Heat shock 70 kDa protein 8, Heat shock protein family A member 8, Lipopolysaccharide-associated protein 1
Gene names
HSPA8
Protein family
Belongs to the heat shock protein 70 family
Function
Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, chaperone-mediated autophagy, activation of proteolysis of misfolded proteins, formation and dissociation of protein complexes, and antigen presentation. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation (PubMed:21148293, PubMed:21150129, PubMed:23018488, PubMed:24732912, PubMed:27916661, PubMed:2799391, PubMed:36586411). This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones (PubMed:12526792, PubMed:21148293, PubMed:21150129, PubMed:23018488, PubMed:24732912, PubMed:27916661). The co-chaperones have been shown to not only regulate different steps of the ATPase cycle of HSP70, but they also have an individual specificity such that one co-chaperone may promote folding of a substrate while another may promote degradation (PubMed:12526792, PubMed:21148293, PubMed:21150129, PubMed:23018488, PubMed:24732912, PubMed:27916661). The affinity of HSP70 for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. HSP70 goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. The HSP70-associated co-chaperones are of three types: J-domain co-chaperones HSP40s (stimulate ATPase hydrolysis by HSP70), the nucleotide exchange factors (NEF) such as BAG1/2/3 (facilitate conversion of HSP70 from the ADP-bound to the ATP-bound state thereby promoting substrate release), and the TPR domain chaperones such as HOPX and STUB1 (PubMed:24121476, PubMed:24318877, PubMed:26865365, PubMed:27474739). Plays a critical role in mitochondrial import, delivers preproteins to the mitochondrial import receptor TOMM70 (PubMed:12526792). Acts as a repressor of transcriptional activation. Inhibits the transcriptional coactivator activity of CITED1 on Smad-mediated transcription. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed:10722728, PubMed:11276205). Substrate recognition component in chaperone-mediated autophagy (CMA), a selective protein degradation process that mediates degradation of proteins with a -KFERQ motif: HSPA8/HSC70 specifically recognizes and binds cytosolic proteins bearing a -KFERQ motif and promotes their recruitment to the surface of the lysosome where they bind to lysosomal protein LAMP2 (PubMed:11559757, PubMed:2799391, PubMed:36586411). KFERQ motif-containing proteins are eventually transported into the lysosomal lumen where they are degraded (PubMed:11559757, PubMed:2799391, PubMed:36586411). In conjunction with LAMP2, facilitates MHC class II presentation of cytoplasmic antigens by guiding antigens to the lysosomal membrane for interaction with LAMP2 which then elicits MHC class II presentation of peptides to the cell membrane (PubMed:15894275). Participates in the ER-associated degradation (ERAD) quality control pathway in conjunction with J domain-containing co-chaperones and the E3 ligase STUB1 (PubMed:23990462). It is recruited to clathrin-coated vesicles through its interaction with DNAJC6 leading to activation of HSPA8/HSC70 ATPase activity and therefore uncoating of clathrin-coated vesicles (By similarity)
Catalytic activity
ATP + H2O = ADP + phosphate + H(+)
Subcellular location
Cytoplasm, Melanosome, Nucleus, nucleolus, Cell membrane, Lysosome membrane
Structure
(Microbial infection) Interacts with human herpes virus 1 (HHV-1) transcriptional regulator ICP22; this interaction recruits HSPA8/HSP40 to discrete nuclear foci
Post-translational modification
Acetylated
ISGylated
Trimethylation at Lys-561 reduces fibrillar SNCA binding
Keywords
3D-structure, Acetylation, Alternative splicing, ATP-binding, Autophagy, Cell membrane, Chaperone, Cytoplasm, Direct protein sequencing, Host-virus interaction, Hydrolase, Isopeptide bond, Lysosome, Membrane, Methylation, mRNA processing, mRNA splicing, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repressor, Spliceosome, Stress response, Transcription, Transcription regulation, Ubl conjugation
Sequence
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
UniProt accession: P11142

Data

Formalin-fixed, paraffin-embedded human hepatocellular carcinoma stained with anti-HSP70 using peroxidase-conjugate and DAB chromogen. Note cell cytoplasmic staining of tumor cells
Formalin-fixed, paraffin-embedded human hepatocellular carcinoma stained with anti-HSP70 using peroxidase-conjugate and DAB chromogen. Note cell cytoplasmic staining of tumor cells

FAQ & Publications

Frequently Asked Questions
What species does the rabbit anti-HSP70 monoclonal antibody (ZR152) specifically react with?
The rabbit anti-HSP70 monoclonal antibody (ZR152) is reactive with human species.
What are the recommended storage conditions for the rabbit anti-HSP70 monoclonal antibody (ZR152) to maintain its stability?
For short term storage, keep the antibody at 2-8°C. For longer term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.