| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| isotype | IgG |
| clonality | protein |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Canine distemper virus |
| available sizes | 100 µg |
Recombinant human TPO
$1,327.00
Antibody summary
- protein to Recombinant human TPO
- Suitable for: ELISA
- Isotype: Whole IgG
- 100 µg
Recombinant human TPO
| antibody |
|---|
| Tested applications ELISA |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions After reconstitution, store at -70°C. Avoid repeated freezing and thawing. |
| Storage buffer Lyophilized from 20 mM Tris-HCl, pH 8.0, 250 mM NaCl, 0.1 mM KI, 5% D-manniol |
| Clonality protein |
| Isotype none |
| Compatible secondaries tbd |
| Isotype control tbd |
| target relevance |
|---|
| Homo sapiens TPO Thyroid peroxidase |
| Protein names Thyroid peroxidase |
| Gene names TPO |
| Protein family Belongs to the peroxidase family. XPO subfamily |
| Function Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4) |
| Catalytic activity 2 iodide + H2O2 + 2 H(+) = diiodine + 2 H2O [thyroglobulin]-L-tyrosine + iodide + H2O2 + H(+) = [thyroglobulin]-3-iodo-L-tyrosine + 2 H2O [thyroglobulin]-3-iodo-L-tyrosine + iodide + H2O2 + H(+) = [thyroglobulin]-3,5-diiodo-L-tyrosine + 2 H2O 2 [thyroglobulin]-3,5-diiodo-L-tyrosine + H2O2 = [thyroglobulin]-L-thyroxine + [thyroglobulin]-dehydroalanine + 2 H2O [thyroglobulin]-3-iodo-L-tyrosine + [thyroglobulin]-3,5-diiodo-L-tyrosine + H2O2 = [thyroglobulin]-3,3',5-triiodo-L-thyronine + [thyroglobulin]-dehydroalanine + 2 H2O |
| Subcellular location Cell surface |
| Structure Interacts with DUOX1, DUOX2 and CYBA |
| Post-translational modification Glycosylated Heme is covalently bound through a H(2)O(2)-dependent autocatalytic process. Heme insertion is important for the delivery of protein at the cell surface Cleaved in its N-terminal part |
| Involvement in disease Thyroid dyshormonogenesis 2A A disorder due to defective conversion of accumulated iodide to organically bound iodine. The iodide organification defect can be partial or complete. |
| Keywords Alternative splicing, Calcium, Congenital hypothyroidism, Disease variant, Disulfide bond, EGF-like domain, Glycoprotein, Heme, Hydrogen peroxide, Iron, Membrane, Metal-binding, Oxidoreductase, Peroxidase, Proteomics identification, Reference proteome, Signal, Sushi, Thyroid hormones biosynthesis, Transmembrane, Transmembrane helix |
| Sequence MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG RAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA LKALNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPT VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIR GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ MKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFES CDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQL TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD SGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL |
| UniProt accession: P07202 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the Recombinant human TPO antibody been validated for?
The Recombinant human TPO antibody is tested and suitable for ELISA applications. It is also applicable for ICC/IF and Western Blot (WB) techniques.
How should the Recombinant human TPO antibody be stored after reconstitution?
After reconstitution, the Recombinant human TPO antibody should be stored at -70°C. It is important to avoid repeated freezing and thawing to maintain antibody integrity.
What is the concentration and form of the Recombinant human TPO antibody provided?
The antibody is supplied lyophilized at a concentration of 1 mg/mL and in a size of 100 µg per vial.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.