Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human liver stained with anti-glutamine synthetase antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of hepatocytes around a central vein.

mouse anti-Glutamine synthetase monoclonal antibody (ZM377) 6198

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Glutamine synthetase
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b/κ
Control: Normal liver
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6198parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, GI Pathology, Glutamine synthetase

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b/κ
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Glutamine synthetase monoclonal antibody ZM377 6198

antibody
Database link: human P15104
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Normal liver
Immunogen Recombinant fragment (around aa 50-250) of human GLUL protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens GLUL Glutamine synthetase
Protein names Glutamine synthetase
Alternative names Glutamate--ammonia ligase, Palmitoyltransferase GLUL
Gene names GLUL
Protein family Belongs to the glutamine synthetase family
Function Glutamine synthetase that catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine (PubMed:16267323, PubMed:30158707, PubMed:36289327). Its role depends on tissue localization: in the brain, it regulates the levels of toxic ammonia and converts neurotoxic glutamate to harmless glutamine, whereas in the liver, it is one of the enzymes responsible for the removal of ammonia (By similarity). Plays a key role in ammonium detoxification during erythropoiesis: the glutamine synthetase activity is required to remove ammonium generated by porphobilinogen deaminase (HMBS) during heme biosynthesis to prevent ammonium accumulation and oxidative stress (By similarity). Essential for proliferation of fetal skin fibroblasts (PubMed:18662667). Independently of its glutamine synthetase activity, required for endothelial cell migration during vascular development: acts by regulating membrane localization and activation of the GTPase RHOJ, possibly by promoting RHOJ palmitoylation (PubMed:30158707). May act as a palmitoyltransferase for RHOJ: able to autopalmitoylate and then transfer the palmitoyl group to RHOJ (PubMed:30158707). Plays a role in ribosomal 40S subunit biogenesis (PubMed:26711351). Through the interaction with BEST2, inhibits BEST2 channel activity by affecting the gating at the aperture in the absence of intracellular L-glutamate, but sensitizes BEST2 to intracellular L-glutamate, which promotes the opening of BEST2 and thus relieves its inhibitory effect on BEST2 (PubMed:36289327)
Catalytic activity L-glutamate + NH4(+) + ATP = L-glutamine + ADP + phosphate + H(+) L-cysteinyl-[protein] + hexadecanoyl-CoA = S-hexadecanoyl-L-cysteinyl-[protein] + CoA
Subcellular location Cytoplasm, cytosol, Microsome, Mitochondrion, Cell membrane
Structure Decamer; composed of two pentamers (PubMed:18005987). Interacts with PALMD (By similarity). Interacts with RHOJ (PubMed:30158707). Interacts with BEST2; this interaction tethers a fraction of GLUL to the membrane, causing a decrease of cytosolic glutamine synthase (GS) activity and inhibits the chloride channel activity of BEST2 by affecting the gating at the aperture in the absence of intracellular glutamate (PubMed:36289327)
Post-translational modification Acetylated by EP300/p300; acetylation is stimulated by increased glutamine levels and promotes ubiquitin-mediated proteasomal degradation Palmitoylated; undergoes autopalmitoylation Ubiquitinated by ZNRF1 (By similarity). Ubiquitinated by the DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex called CRL4(CRBN), leading to proteasomal degradation (PubMed:26990986)
Involvement in disease Glutamine deficiency, congenital An autosomal recessive disorder characterized by variable brain malformations, encephalopathy, severe developmental delay, seizures, and decreased glutamine levels in bodily fluids. Death in early infancy may occur. Developmental and epileptic encephalopathy 116 A form of epileptic encephalopathy, a heterogeneous group of early-onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. DEE116 is autosomal dominant form characterized by severe developmental delay, seizures, and white matter abnormalities.
Keywords 3D-structure, Acetylation, Angiogenesis, ATP-binding, Cell membrane, Cytoplasm, Disease variant, Endoplasmic reticulum, Epilepsy, Intellectual disability, Ligase, Lipoprotein, Magnesium, Manganese, Membrane, Metal-binding, Microsome, Mitochondrion, Nucleotide-binding, Palmitate, Phosphoprotein, Proteomics identification, Reference proteome, Transferase, Ubl conjugation
Sequence MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRI MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDP KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL LNETGDEPFQYKN
UniProt accession: P15104

Data

Formalin-fixed, paraffin-embedded human liver stained with anti-glutamine synthetase antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of hepatocytes around a central vein.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-Glutamine synthetase monoclonal antibody (ZM377) suitable for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

What are the recommended storage conditions for the mouse anti-Glutamine synthetase monoclonal antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

Which species does the mouse anti-Glutamine synthetase monoclonal antibody (ZM377) react with?

This antibody specifically reacts with human Glutamine synthetase.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.