Immunohistochemistry (IHC) : Human thyroid tissue stained with anti-CD34 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of vascular endothelial cells.

mouse anti-CD34 monoclonal antibody (QBEnd-10) 6088

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD34
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Hemangioma
Visualization: Cell membrane/cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6088parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD34, Vascular Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD34 monoclonal antibody QBEnd-10 6088

antibody
Database link: human P28906
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Hemangioma
Immunogen Detergent solubilized vesicular suspension prepared from a perfusate of human term placenta
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CD34 Hematopoietic progenitor cell antigen CD34
Protein names Hematopoietic progenitor cell antigen CD34
Gene names CD34
Protein family Belongs to the CD34 family
Function Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins
Subcellular location Membrane
Post-translational modification Highly glycosylated Phosphorylated on serine residues by PKC
Keywords Alternative splicing, Cell adhesion, Direct protein sequencing, Glycoprotein, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix
Sequence MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ ENGTGQATSRNGHSARQHVVADTEL
UniProt accession: P28906

Data

Human thyroid tissue stained with anti-CD34 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of vascular endothelial cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution range for the mouse anti-CD34 monoclonal antibody (QBEnd-10) when used in immunohistochemistry?

For immunohistochemistry applications, the concentrated mouse anti-CD34 monoclonal antibody (QBEnd-10) is recommended to be diluted between 1:100 and 1:200.

How should the mouse anti-CD34 monoclonal antibody (QBEnd-10) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.